(data stored in ACNUC1104 zone)

EMBL: CP002026.PE524

CP002026.PE524       Location/Qualifiers
FT   CDS_pept        complement(553326..554093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0528"
FT                   /product="putative hydrolase protein"
FT                   /note="KEGG: rlt:Rleg2_2054 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87861"
FT                   /db_xref="GOA:D7A441"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A441"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_2054"
FT                   /protein_id="ADH87861.1"
FT                   /translation="MGLNSLISLSLAGGMLLALAAGVPAHAADPVRNVVIVHGALADGS
FT                   GWRKVHDLLVAKGYNVTVVQPPMTTLEADVAAARRILDLQEGPSVLVGHSYGGMIITEA
FT                   GNADNVASLVYIAAFQPDAGENLLDLAGRTPPATTGIKATEDGFLYLDPKVYAADFAAD
FT                   VPAAEAKFMANSQVFPSKVAFETRIKHPAWKGKKSWALIATDDRAINPELMRFMAKRAG
FT                   STPVEVKGSHAVFMSQPEAVAALIEKAAKAPAK"
     atgggactga actcgcttat ctcgctgtcg cttgccggcg gcatgcttct cgcactcgcc        60
     gccggcgtgc cggcgcatgc cgccgatccg gtcaggaacg tcgtcatcgt ccatggggcg       120
     ctggccgacg gatcgggctg gcgcaaggtg catgacctgc tcgtcgccaa gggctacaac       180
     gtcaccgtcg tgcagccgcc gatgaccacg ctggaggccg acgtcgcggc ggccaggcgc       240
     atcctcgacc tgcaggaagg cccgtccgtg ctggtcggcc actcctatgg cggcatgatc       300
     atcaccgagg ccggcaacgc cgacaacgtc gcgagcctcg tctacatcgc cgccttccag       360
     ccggatgccg gcgagaacct gctcgacctc gccggccgca cgccgcccgc gacgaccggc       420
     atcaaggcga cggaggacgg gtttctctat ctcgatccga aggtctatgc cgccgacttc       480
     gccgccgacg tgccggcggc ggaagcgaag ttcatggcca attcgcaggt cttcccgtcc       540
     aaggtcgctt tcgagacccg gatcaagcac ccggcctgga agggcaagaa gagctgggcg       600
     ctcatcgcca ccgacgaccg ggcgatcaac ccggagctga tgcgctttat ggccaagcgc       660
     gccggcagca cacccgtcga ggtcaagggc agccacgccg tgttcatgtc gcagccggaa       720
     gcggtggcgg cgctgatcga gaaggctgcc aaggctcctg cgaagtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page