(data stored in ACNUC1104 zone)

EMBL: CP002026.PE525

CP002026.PE525       Location/Qualifiers
FT   CDS_pept        complement(554305..555336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0529"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="TIGRFAM: 1-aminocyclopropane-1-carboxylate
FT                   deaminase; KEGG: smd:Smed_6456
FT                   1-aminocyclopropane-1-carboxylate deaminase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87862"
FT                   /db_xref="GOA:D7A442"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7A442"
FT                   /inference="protein motif:TFAM:TIGR01274"
FT                   /protein_id="ADH87862.1"
FT                   /translation="MSLFVSLLDKFERYPLTFGPTPIEPLPRLSAALGGKVEIYAKRDD
FT                   CNSGLAMGGNKLRKLEYIVPDAIACGADTLVSIGGVQSNHTRMVAATAAKIGMKCVVIQ
FT                   EKWVPHYDAVYDRVGNILMTRLMGADSRLIDAGFDIGIRQSWEDAIRSVEAMGGRPYPI
FT                   PAGASVHKFGGLGYVGFAEEVARQEEELGFRFDYIIVCVVTGSTQAGMIVGFAHQGRAE
FT                   RVIGIDASGTLERTRAQVRRIVDDTAELVGLGRTVREDEIVINPDYAYPAYGVPSEETN
FT                   EAIRLAARTEAMITDPVYEGKSMQGLIDLTRKGFFPDGSKVLYAHLGGVPAINGYSYYY
FT                   KDG"
     gtgtcactct tcgtgtcgct tctcgataaa ttcgaacgct atcccctcac cttcggcccg        60
     acgccgatcg agccgctgcc gcggttgtcg gcggcgctcg gcggcaaggt cgagatctac       120
     gccaagcgcg acgactgcaa ttccggcctc gccatgggcg gcaacaagct gcgcaagctc       180
     gaatatatcg tgccggacgc catcgcttgc ggagccgaca cgctggtctc catcggcggc       240
     gtgcagtcga accatacccg catggtcgcg gcgaccgccg ccaagatcgg catgaaatgc       300
     gtggtgatcc aggagaaatg ggtcccgcat tacgacgccg tctatgatcg ggtcggcaac       360
     atattgatga cccggctgat gggtgccgac agccggctga tcgatgccgg cttcgacatc       420
     ggcatccgcc agagctggga ggacgccatc cgctcggtcg aggcgatggg cggccggccc       480
     tatccaatcc cggccggcgc ctcggtgcac aagttcggcg ggctcggcta tgtcggcttc       540
     gccgaggagg tcgcccggca ggaggaagaa ctcggcttcc gcttcgacta catcatcgtc       600
     tgtgtagtca ccggctcgac ccaggccggc atgatcgtcg gcttcgccca tcagggccgg       660
     gccgagcggg tcatcggcat cgacgcttcc ggcacgctgg agcggacgag ggcgcaggtg       720
     cgccgcatcg tcgacgacac cgctgaactc gtcggcctcg gccgcacggt ccgcgaggac       780
     gagatcgtca tcaatccgga ctacgcctac cccgcctatg gcgtgccgtc ggaagagacc       840
     aacgaggcga tccgcctcgc cgcccggacc gaggcgatga tcaccgaccc ggtctatgag       900
     ggcaaatcca tgcagggcct gatcgacctg acgcgcaagg gcttcttccc cgacggctcg       960
     aaggtcctct acgcccatct cggcggcgtg ccggcaatca acggctacag ctactactac      1020
     aaggacggct ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page