(data stored in ACNUC1104 zone)

EMBL: CP002026.PE527

CP002026.PE527       Location/Qualifiers
FT   CDS_pept        complement(556037..556330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0531"
FT                   /product="putative ATPase with chaperone activity"
FT                   /note="KEGG: bpt:Bpet4107 putative ATPase with chaperone
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87864"
FT                   /db_xref="UniProtKB/TrEMBL:D7A444"
FT                   /inference="similar to AA sequence:KEGG:Bpet4107"
FT                   /protein_id="ADH87864.1"
FT                   /translation="MVDTAEVAASICLARPDPETYGELASFALPIIDVDMRHQIAEALT
FT                   AIIAQAEATRRNALKLPGGSAEVIASSEHIVVCAKRIWQLIDDPQGSGKRRR"
     gtggtcgaca cggccgaagt ggcggcgtcg atctgcctcg cccggcccga tcccgaaaca        60
     tatggcgagc tggcctcgtt cgccctgccg atcatcgacg tcgacatgcg ccaccagatc       120
     gcggaggcgc tcaccgccat catcgcccag gccgaggcga cgcgccgcaa tgctctgaag       180
     ctgccggggg gcagcgccga ggtgatcgcc tcttccgagc atatcgtcgt gtgcgccaag       240
     cgtatctggc agctgatcga cgacccgcag ggctcgggca agcgccgtcg ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page