(data stored in ACNUC1104 zone)

EMBL: CP002026.PE528

CP002026.PE528       Location/Qualifiers
FT   CDS_pept        complement(556492..559431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0532"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   NB-ARC domain protein; KEGG: bja:blr6255 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87865"
FT                   /db_xref="GOA:D7A445"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A445"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADH87865.1"
FT                   /translation="MIERDAASVGQLSFGPFTFFPGQQLLVEDETPINLGSRARAILLA
FT                   LLEQQGEVVSKAQLIQRAWPDTFVEEANLRVHIGALRRALGDGQDGRRYIVNIPGRGYS
FT                   FVFPVERSDAVGAREMPPALAADSPSLPPALARIVGRSETVQQVKALLVEQRFVSIVGP
FT                   GGIGKSTVAIAVAHEMRGRFSEGVCFVDLSALGDPQLVPAALAAALGVGLRSESPTQSL
FT                   IAATRAKPLLLLLDSCEHVIETVSHLAEQLFGNGGEDLHILATSREPLRVEGERIHRLS
FT                   SLDVPPTRANLSSAEALAYPAVQLFVERAAANLGGFQLTDAEAPLVAYLCRRLDGIALA
FT                   IEIAAGRVESLGVAGLASRLDDRFRLQLQGRRTALRRHQTLSTLLDWSYALLPPFEQLV
FT                   LRQLAILAGNFTMDDAVAIIADDEATDSEIVNAVANLVEKSLITADVHGLQAHYRLLDT
FT                   TRAYAAVKLAESGKVELLRRRHAAIFRDALHRANLAWEIQPAPAWTEDHRHLIDNVRAA
FT                   LDWAFSPKGDAEIGVALTLGAVPLWFQLQLIAESHQQVRLALASTDLDRAPHIQMRLQA
FT                   VLAWSLMQIRGQVDETRTAWERTLELAEALDDRDYQLRALWGLWSGLLNQSRFREALAL
FT                   AHRFAEVAARGSDLNDSYVGYRMIGYILHLLGRQTEARRYLEPMVKGYVVPITGSQIIR
FT                   FVFEQKATGRCFLARILWLQGSFDAAIAEIDDIVASAEASDDRLTLCQVLVQAACPVAF
FT                   FADDLVRARRFVGMLVDESARDGIEFWQVWGQCFAGVLMIREGDLSNGIKSLGEALGRL
FT                   RNISYGVYYIVFLAEYAAALAQVGEFDRALSCLEEALARSEQNEEGWFAPELWRLAGEL
FT                   AALRGGTDAGGEAEQRLATALNIAREQEALFWEIKAAVSLARLWQRQDRVREAEALLAP
FT                   LVSRFAGSLDQPLLREAAELSDRLKTAASPVGKSKYRKPLDGPATRTLQ"
     gtgatcgaac gggacgcagc gtcagtcggg cagctgtcct tcgggccttt caccttcttc        60
     cctgggcagc aactcctggt ggaggacgag accccgatca atctcggcag cagggcgcgg       120
     gcgatcctgc tcgcccttct cgagcagcag ggcgaagtgg tcagcaaggc gcagctgatc       180
     cagcgcgcct ggccggacac gttcgtggaa gaggccaatc tccgcgtgca tatcggcgcg       240
     ctgcggcgcg ctctcggcga cggacaggac ggccgccgtt acatcgtcaa catccccgga       300
     cggggctatt ccttcgtctt cccggtggaa cgctcggatg cggtcggtgc gcgggagatg       360
     cccccggccc tggcggcgga cagcccgagc cttccgccgg cgctcgcccg tatcgtcggc       420
     cgcagcgaaa ccgtccagca ggtgaaggcc ctgctggtag agcagcgctt cgtctccatc       480
     gtcgggccgg gcggcatcgg caaatcgacg gtggccatcg cggtcgcgca cgaaatgcgg       540
     ggccgcttca gcgagggcgt ctgcttcgtc gacctatccg cgctcggcga tccccagctc       600
     gtgccggcgg cgctcgccgc ggcgctgggt gtgggtcttc gctcggaatc gccgacgcag       660
     agcctgatcg ccgcgacgcg ggcgaagccg ctgctccttc tcctcgacag ctgcgagcat       720
     gtcatcgaga ccgtctcgca cctcgccgaa cagctcttcg gcaatggcgg cgaggacctc       780
     catatcctcg ccaccagccg cgagccgctg cgcgtcgagg gcgagcgcat ccatcggctg       840
     tcctcgctcg acgtgccgcc tacgagggcg aacctctcca gcgccgaggc cctcgcctat       900
     ccggcggtgc agctcttcgt cgagcgcgcc gcggccaatc tcggcggctt ccagctcacc       960
     gacgcggaag cgcccctcgt cgcctatctc tgccgccggc tggacgggat cgcgctcgcc      1020
     atcgagatcg cggcgggacg ggtcgaaagc ctcggcgtcg cgggcctggc gagccggctg      1080
     gacgaccgct tccgcctgca gctgcagggc cgccggaccg cgctccgccg ccaccagacg      1140
     ctcagcaccc tgctcgactg gagttacgcg ctgctgccgc ccttcgagca gctcgtgctc      1200
     cggcagctcg ccatcctcgc cggcaatttc accatggacg acgcggtcgc catcatcgcc      1260
     gacgacgagg ccacggattc ggagatcgtc aacgccgtcg ccaatctcgt cgagaagtcg      1320
     ctgatcaccg ccgatgtgca tggcctgcag gcgcactacc ggctgctcga cacgacgcgg      1380
     gcctatgcgg ccgtgaagct ggcggagagc ggcaaggtcg agctgcttcg gcgccgtcac      1440
     gcggccatct tccgcgacgc tctccaccgc gccaacctcg cctgggagat ccagcccgcc      1500
     ccggcatgga ccgaggacca ccggcatctg atcgacaatg tgcgcgccgc tctggactgg      1560
     gcgttctcgc cgaaaggcga tgcagagatc ggcgtcgcgc tcaccctcgg agcggtgccc      1620
     ctctggttcc agctccagct catcgccgag tcccaccagc aggtgcggct ggcgcttgcg      1680
     agcaccgacc ttgaccgcgc gccacacatc cagatgcgcc tgcaggccgt gctcgcctgg      1740
     tcgctgatgc agatcagggg acaggtggac gagacccgca ccgcctggga gcggacgctc      1800
     gagctcgccg aggcgctgga cgaccgggac taccagctgc gcgccctgtg gggcctctgg      1860
     tcgggcctgc tcaaccagag ccggttcagg gaggcgctgg cgctggcgca tcgcttcgcg      1920
     gaggtggccg cgcgcggcag cgacctgaac gacagctatg tcggctaccg catgatcggc      1980
     tacatcctgc atctgctcgg ccggcagacg gaggcgcggc gctatctcga gccgatggtg      2040
     aagggctatg tcgtccccat caccggctcg cagatcatcc gcttcgtgtt cgagcagaag      2100
     gccaccggcc gctgcttcct cgcccgcatc ctctggcttc agggctcgtt cgatgcggcc      2160
     attgccgaga tcgacgacat cgtcgcctcc gccgaggcca gcgacgaccg gctgacgctc      2220
     tgccaggtgc tggtgcaggc ggcatgcccg gtcgcgttct tcgccgacga cctcgtccgc      2280
     gcgcgccgct tcgtcggtat gctcgtcgat gaatcggcgc gggacgggat cgagttctgg      2340
     caggtctggg gccagtgctt cgccggcgtc ctcatgatcc gcgaaggcga cctttccaac      2400
     ggcatcaaga gcctggggga agcgctgggc cggctgcgga acatctccta cggcgtctac      2460
     tacatcgtct tccttgccga atatgccgcg gcattggccc aagtcggcga gttcgaccgc      2520
     gctttgtcct gtctggagga ggccctggcc cgctcggagc agaacgagga aggctggttc      2580
     gcccccgagc tctggcggct cgccggcgaa cttgctgcgc tcaggggcgg caccgacgcc      2640
     ggcggcgaag ccgagcagcg gctggcgacg gccctgaaca tcgcccgcga gcaggaggcg      2700
     ctgttctggg agatcaaggc cgcggtcagc ctcgcccgtc tgtggcagag gcaggatcgc      2760
     gtacgggagg ccgaagccct cctggcgccg ctggtcagcc ggttcgccgg cagccttgat      2820
     cagccgctgt tgagggaggc ggccgagctg tccgacaggt tgaagacggc ggcgagccct      2880
     gtgggcaaat ccaaatacag gaagccgctc gacggcccgg cgacgaggac gctgcaatag      2940
//

If you have problems or comments...

PBIL Back to PBIL home page