(data stored in ACNUC1104 zone)

EMBL: CP002026.PE529

CP002026.PE529       Location/Qualifiers
FT   CDS_pept        complement(559532..560323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0533"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mll4146 sugar ABC
FT                   transporter permease protein ThuG"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87866"
FT                   /db_xref="GOA:D7A446"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A446"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87866.1"
FT                   /translation="MLRRSLLYWGALLPLLGLNLFPFAVALDTIYRRRGGEDMGAFWAG
FT                   MWLRTELGTSLVNSLVIALATAIASTLVALPAAYALSRFRFRGRRAFSEALLGTQMLTP
FT                   IMLVLGLSQMIAGMGLTDTRFALVLLYSAFQVPFAVWMLRGYIDAIPVELEEAALLDGA
FT                   SRRQILGSIILPLSVPAILVTATFAFITAFNEFVLALTLLRSPANFTLPLRVNALTAGR
FT                   YAVDWPDVMAAVLVASLPVLIMFIGLQRYMLRGLRLSLGAT"
     atgcttaggc gcagcctgct ctactggggc gccctcctcc cgctgctcgg cctgaacctg        60
     tttcccttcg cggtggcgct cgacaccatc tatcgccgca ggggcggcga ggacatgggc       120
     gccttctggg ccggcatgtg gctcaggacc gagctcggca cgtccctcgt caacagcctc       180
     gtcatcgccc ttgcaaccgc catcgcctcg accctcgtcg ccctgcccgc ggcctatgcc       240
     ctctcccgct tccgtttccg cggccggcgg gccttttccg aggcgctgct tggcacgcag       300
     atgctcacgc cgatcatgct ggtgctgggt ctttcccaga tgatcgcggg aatgggcctc       360
     accgacacgc gcttcgcgct ggtgctgctc tattcagcgt tccaggtgcc cttcgccgtg       420
     tggatgctgc gcggctatat cgacgcgatc ccggtggaac tggaggaggc ggccctgctc       480
     gatggcgcct cgcgccggca gatactcggc tcgatcatcc ttccactgtc cgtgccggcc       540
     atcctggtga cggcgacctt cgccttcatc accgccttca acgaattcgt gctggcgctg       600
     acgctgctgc ggagcccggc caacttcacg ctgccgctga gggtcaacgc gctgaccgcc       660
     ggacgctacg cggtcgactg gcccgacgtg atggccgcgg tcctcgtcgc cagcctgccc       720
     gtgctgatca tgttcatcgg gttgcaacga tacatgctgc gcggccttcg cctcagcctc       780
     ggcgcgacat ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page