(data stored in ACNUC1104 zone)

EMBL: CP002026.PE531

CP002026.PE531       Location/Qualifiers
FT   CDS_pept        complement(561211..562434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0535"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: oan:Oant_3895 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87868"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7A448"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH87868.1"
FT                   /translation="MTRLAKIFLILSLALLSLGIPGAQAVDLRFTAGEYSGFTRPFLER
FT                   VARDYEVLHPGTRIQIEVIPWDSYLQKLTTDISSGDQPDLSIVPTMWISDLAADGLLEP
FT                   LDGLASPEFKAKFIPAFLVPATVKGQLLGFPAAASARAMVVNTELLQKAGAPEPKTWDA
FT                   LRTAAQKIAALPNTYGFGLPGKEVEVDTYFYYALWGFGGEIIKDGKSGLSSPEAIRAAT
FT                   FYMSLINDKATEPAPTAHSREDIFKLFKEGRIGIIFTYPMLVPQLKTEAPNLKYAVMPF
FT                   PVETKPVTLGVTDVLTMSSSSKNKQEAFDFLQFLYSDKYRTEFDRAEGLLPVTVSEAAS
FT                   SYYKDNPDIAAFAAGLAYARFFPTIKGWPEISDITVRALQTMYLGQKTSTEAMTDAARQ
FT                   IDDVLARR"
     atgacgcgcc tcgcgaaaat ctttctcata ttgtctttgg cgttgctttc gctggggatc        60
     cccggcgctc aagcggtgga tcttcggttt accgcgggag aatactcggg atttacgcgg       120
     ccgtttcttg aacgcgtcgc gcgcgactac gaagtgctgc atccgggtac acgcatccag       180
     atcgaggtca ttccgtggga cagctatttg cagaagctga ccaccgacat cagcagcggc       240
     gatcaacccg atctctcgat cgtgccgacc atgtggatct ccgatctcgc cgcggacggc       300
     cttctcgaac cgctcgacgg gctggcgtca cccgaattca aggcgaagtt cattcccgcc       360
     ttcctggtgc cggctaccgt caaggggcag cttctcggct tcccggccgc ggcctcggcg       420
     cgggcgatgg tggtgaatac cgagttgctg cagaaggccg gcgcgcccga gccgaagacg       480
     tgggacgcgc tgcgcaccgc cgcccagaag atcgccgccc tgccgaacac ctatggcttc       540
     ggcctgccgg gcaaggaagt cgaggtcgac acctatttct actatgcgct ctggggtttc       600
     ggcggcgaga tcatcaagga cggcaagagc ggcctctctt cgcccgaggc catccgcgcc       660
     gcgaccttct acatgtcgct gatcaacgac aaggcgaccg agccggcacc cacggcgcat       720
     agccgcgagg acatcttcaa gctgttcaag gaaggacgca tcggcatcat cttcacctat       780
     ccgatgctgg tcccgcagct gaagaccgag gcgccgaacc tcaaatatgc cgtcatgccg       840
     tttccggtcg agaccaagcc ggtcacgctc ggggtgaccg acgtgctgac catgtcgagc       900
     tcgtcgaaga acaagcagga ggccttcgat ttcctgcaat tcctctatag cgacaagtac       960
     cgcaccgaat tcgaccgcgc cgaggggttg cttcccgtca ccgtctcgga ggccgccagc      1020
     agctattaca aggacaatcc ggacatcgcc gccttcgccg ccggcctcgc ctatgcgcgc      1080
     ttcttcccga ccatcaaggg ctggccggaa atctcggaca tcaccgtgcg cgccctgcag      1140
     accatgtatc tcggccagaa gacatcgacc gaagcgatga ccgatgccgc gcggcagatc      1200
     gacgacgtcc ttgcccgccg ctga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page