(data stored in ACNUC1104 zone)

EMBL: CP002026.PE532

CP002026.PE532       Location/Qualifiers
FT   CDS_pept        complement(562903..563268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0536"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /note="KEGG: efe:EFER_3975 conserved hypothetical protein;
FT                   putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87869"
FT                   /db_xref="GOA:D7A449"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D7A449"
FT                   /inference="similar to AA sequence:KEGG:EFER_3975"
FT                   /protein_id="ADH87869.1"
FT                   /translation="MPERREARAPGLQPERTALSWSRTGFLALLVAALLGRAGTPAASL
FT                   IELALILLLVPMAGLFLYRGFRIPCDGNAKHDDVAERRSALLFVCLGIAALAGLHGMAT
FT                   LGRIVVYLQSHGIDMRM"
     atgccggaac ggcgcgaggc cagggccccc ggactgcagc cggaacgcac ggcgctttcc        60
     tggtcgcgca ccggctttct ggccctgctc gtggccgcgc tcctcggacg ggccggcacg       120
     ccggcggcga gcctgatcga gctggcgctg atcctgctgc tcgtgcccat ggccgggctc       180
     ttcctgtatc gaggcttccg gattccctgc gacggaaacg cgaagcatga cgacgtcgcg       240
     gagcgccgga gcgccctgct gttcgtctgt ctcggcatcg ccgcccttgc cggtcttcac       300
     ggcatggcca cgttgggacg tattgtcgtg tatctgcaga gccatggcat cgatatgcgc       360
     atgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page