(data stored in ACNUC1104 zone)

EMBL: CP002026.PE535

CP002026.PE535       Location/Qualifiers
FT   CDS_pept        complement(564073..565317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0539"
FT                   /product="protein of unknown function DUF521"
FT                   /note="PFAM: protein of unknown function DUF521; KEGG:
FT                   mms:mma_2388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87872"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="UniProtKB/TrEMBL:D7A452"
FT                   /inference="protein motif:PFAM:PF04412"
FT                   /protein_id="ADH87872.1"
FT                   /translation="MKLNEEERALLAGEGGRARQWAIRHQIEVGRFFDAEDMVEVDQAH
FT                   VMADPESLGEAGVRWLSDMAGLPEAERRVRVPTITDPRGVDFAAYKRLHQTDEMATLEE
FT                   RAIRAFEAMGVLMTNTCINYQTILPPVRGEHVAFGDTGVVIYSNAVFGARSNFEGGPSA
FT                   IAAGLTGRTPRYGYHLEKNRLGTKLFELRHQPKDFSEWGALGAVVGRGSGSYWAVPVIT
FT                   GVENAPTSDDLKHFGAALASFGSVAMFHMPGVTPEAPTLADAFDGPPPPASPITAEDIA
FT                   NVYEGYAARGDKVDVVVFSAPQLSLIELEKVANLLDGRRVHSGTTLIAATSPEIKFAAD
FT                   RMGLTRRIEASGGIVLSGVCFYQSYAREMAEANGWSRLMSNSAKLVNIIGGYGYKPTLA
FT                   TMERCVDSAVAGKVL"
     atgaaactca atgaagaaga acgtgcattg cttgcgggtg aaggcggccg tgcccgtcaa        60
     tgggccatcc gccatcagat cgaggtcggc cggtttttcg acgccgagga catggtggag       120
     gtcgaccagg cccatgtcat ggccgatccg gagagcctgg gagaggccgg cgtgcgctgg       180
     ctctccgaca tggccgggct gccggaagcc gagcggcgcg tgcgcgtgcc gaccatcacc       240
     gatccgcgcg gcgtcgactt cgcagcctat aagcggctgc accagaccga cgagatggcg       300
     acgctggagg aacgcgccat ccgcgccttc gaggccatgg gcgtgctgat gaccaatacc       360
     tgcatcaact accagaccat cctgcctccg gtccgcggcg agcacgtcgc gttcggcgat       420
     accggcgtgg tcatctattc caacgcggtg ttcggcgcgc gctcgaattt cgagggcggc       480
     ccgtcggcga tcgccgccgg cctgaccggg cgcacgccgc gctatggcta ccatctcgag       540
     aagaaccgcc tcggtaccaa gctcttcgag ctgcgccatc agccgaagga cttcagcgaa       600
     tggggcgcgc tcggcgccgt cgtcggccgc ggctcgggaa gctattgggc ggtgccggtc       660
     atcaccggcg tggagaacgc cccgacctcc gacgacctca agcatttcgg cgcggcgctc       720
     gcgagcttcg gatcggtggc catgttccac atgcccggtg tcacccccga ggcgccgacg       780
     ctggcggatg ccttcgacgg ccctccgccg ccggcctcgc ccatcaccgc cgaggacatc       840
     gccaatgtct atgagggcta cgcggcccgc ggcgacaaag tcgacgtggt ggtcttctcc       900
     gcgccgcagc tctcgctgat cgaactggag aaggtagcga acctgctcga cggacggcgc       960
     gtccattccg gcacgacact gatcgcggcg acctcgcccg agatcaagtt cgccgccgac      1020
     cgcatggggc tcacccgccg gatcgaggcg tcgggcggga tcgtcctgtc cggcgtctgc      1080
     ttctaccaga gctatgcgcg cgagatggcc gaagccaatg gctggagccg actcatgtcc      1140
     aactccgcca agctcgtgaa catcatcggc ggctacggct acaagccgac gctcgccacc      1200
     atggagcgct gcgtcgacag cgccgtcgcc ggaaaggtgc tgtga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page