(data stored in ACNUC1104 zone)

EMBL: CP002026.PE536

CP002026.PE536       Location/Qualifiers
FT   CDS_pept        complement(565314..566588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0540"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="KEGG: rpa:RPA1784 TRAP dicarboxylate family
FT                   transporter DctM subunit; TIGRFAM: TRAP dicarboxylate
FT                   transporter, DctM subunit; PFAM: TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87873"
FT                   /db_xref="GOA:D7A453"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7A453"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ADH87873.1"
FT                   /translation="MTSGIAITVLFLLLMVASLPVFVAMGIAGFLGFALSKGLDGALYG
FT                   FTETLWQATHVYELIAIPLFILTGTVMQQSGAGRDLFAVVNAFAGRVRNATGVATILAC
FT                   GIFAAICGSSIATAATVGLVAVPALREQGYGDARAGGFVAAGGTLGILIPPSIPLILYG
FT                   IITDTSIGQLFIAGVVPGILMMGVFAAYALWSRPQVVVNGSEGGDRWALLRGSVGVLLL
FT                   PPVIVGAIYLGLFTPTEVGALAVIYVAGLGLLQRRLDGRKLVAAVLAATRTTVMLMMLI
FT                   VFGQYFAHYLTYEEVPQIIAQSITQVPGGPLVTITLVVLVYLLLGMFLESAAMLLISVP
FT                   IFFPVAMAIGMDPLTFGIFAIMAMEIAQISPPVGINLFTIHGISRIPLERLALGVLPFI
FT                   GIQIVFLYLIFFMPEIVLWLPGQMK"
     atgacaagcg gcatcgccat caccgtcctg ttcctcctgc tcatggttgc gagcctgccg        60
     gtcttcgtgg ccatgggcat cgccggcttc ctcggcttcg cgctgtcgaa gggcctcgac       120
     ggcgcgctct acggcttcac cgagacgctc tggcaggcga cccatgtcta cgagctgatc       180
     gccatccccc tcttcatcct gacgggaacg gtgatgcagc agagcggcgc gggccgcgac       240
     ctgttcgcgg tggtgaacgc cttcgccgga agggtgcgca acgccaccgg cgtcgccacc       300
     atcctggcat gcggcatctt cgcggccatc tgcggctcct ccatcgccac ggccgccacg       360
     gtcggcctcg tcgccgtgcc ggcgctgcgc gagcagggct atggcgatgc gagggccggc       420
     ggcttcgtgg ccgccggtgg cacgctgggc atcctcatcc caccctccat tccactcatc       480
     ctctacggca tcatcaccga cacatcgatc ggccagctct tcatcgccgg cgtcgtgccg       540
     gggatattga tgatgggcgt gttcgcggcc tatgcgctgt ggtcgcggcc gcaggtggtc       600
     gtgaacggga gcgaaggcgg ggaccgctgg gccctgctgc gcggcagcgt cggcgtcctg       660
     ctgctgccgc cggtgatcgt gggcgccatc tatctcggcc tgttcacgcc gaccgaggtg       720
     ggagctctcg cggtcatcta cgtcgcgggc ctcggcctgc tgcagcggcg gctcgatggc       780
     cgcaagctgg tcgccgccgt gctggccgcc acccgcacga cggtcatgct catgatgctg       840
     atcgtgttcg gccagtattt cgcgcactac ctcacctatg aggaggtacc gcagatcatc       900
     gcccagagca tcacccaggt gcccgggggg ccactcgtca ccatcacctt ggtcgttctg       960
     gtctatctgc tgctcgggat gttccttgaa tcggcggcga tgctgctgat ctcggtgccg      1020
     atcttctttc cggtcgccat ggcgatcggg atggacccgc tgaccttcgg catcttcgcg      1080
     atcatggcga tggagatcgc ccagatctcc ccgccggtcg gcatcaacct cttcaccatc      1140
     cacggcatca gccgcatccc cctggaacgt ctcgcgctcg gcgtgctgcc gttcatcggc      1200
     atccagatcg tctttctcta cttgatcttc tttatgccgg agatcgttct ctggcttccg      1260
     ggacagatga aatga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page