(data stored in ACNUC1104 zone)

EMBL: CP002026.PE539

CP002026.PE539       Location/Qualifiers
FT   CDS_pept        complement(568152..569594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0543"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bbr:BB4315 putative
FT                   sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87876"
FT                   /db_xref="GOA:D7A456"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:D7A456"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ADH87876.1"
FT                   /translation="MPAPSNVLIIMSDEHNKAITGCYGNAVVATPNIDALAARGTLFEA
FT                   AYTNCPVCVPARASFACGRYVHDIGHWDNADPYDGTQRSWHHHLRASGHEVTSIGKLHF
FT                   RSAADDYGFTESLIPMHVVEEKGDLLGLVRDELPKRKGAWKMARLAGPGESSYTFYDRD
FT                   ILARAQIWLRGAAARARAKPWALFVSFVAPHFPLTAPPEHYYRYYDDARLQWPKLYETQ
FT                   ARPEHPYLREYAECFAYDEHFAGPDDVRRALAGYYGLVGFLDENIGKLLATLDATGLSQ
FT                   DTRVVYVSDHGDNLGARGLWGKSTMYEEAVSVPLIAAGPGFEPGKRVRTPVSLVDLSAS
FT                   ILSWCGEEKPTDWPGEDLAGDLPPDRAVFSEYHGMGSKSGFYMLRDRRFKYVHYVDHRA
FT                   QLFDLEADPQELNDLADDPAFSDVRAQLNARLCAICDPNDTDRRAKARQAEQLHRNGGR
FT                   EAVIARGDLGFSPPPGFSPDFM"
     atgcccgccc cctcgaacgt tctcatcatt atgtcggatg agcacaataa ggcgatcacc        60
     ggctgctacg ggaacgccgt tgtcgccacc ccgaacatcg acgcccttgc ggcgcggggg       120
     acgctgttcg aggccgccta caccaactgc ccggtctgcg taccggcgcg cgcgtccttt       180
     gcctgcggcc gctacgtcca cgacatcggc cattgggaca atgccgaccc ctatgacggc       240
     acgcagcgga gttggcacca ccacctgcgc gcgagcgggc acgaggtgac gtccatcggc       300
     aagctgcatt tccgcagcgc cgcggacgac tacggcttca ccgagagcct cattcccatg       360
     catgtggtcg aggagaaggg cgaccttctc ggcctcgtgc gcgacgaact ccccaagcgc       420
     aagggcgcct ggaagatggc ccggctcgcc ggtccggggg agtcgagcta caccttctac       480
     gatcgcgaca tcctcgcgcg tgcccagata tggctgcgtg gcgcggcggc gcgtgcccgt       540
     gcgaagccct gggcgctgtt cgtctcgttc gtcgcgccgc atttcccgct cactgcgccc       600
     cccgagcact attaccgcta ttacgacgac gcccgcctcc aatggcccaa gctctacgag       660
     acgcaggcgc gccccgagca tccctatctg cgcgaatatg ccgagtgctt tgcctatgac       720
     gagcatttcg ccgggccgga cgacgtgcgc cgcgcgctcg ccggctatta cgggctcgtc       780
     ggctttctcg acgagaacat cggcaagctg ctggcgacgc tggacgccac tggcctgtcg       840
     caggacacgc gcgtcgtcta cgtgtccgat catggcgaca atctcggcgc gcgcggcctc       900
     tggggcaagt cgaccatgta tgaggaggcg gtctcggtgc cgctgatcgc ggcgggaccg       960
     ggcttcgagc cgggcaagcg cgtgcgcacg ccggtgtcgc tggtcgatct ctcggcgagc      1020
     atcctgagct ggtgcgggga ggagaagccc accgactggc ccggcgaaga cctcgccggg      1080
     gacctgccgc cagatcgcgc cgtgttctcc gaatatcacg gcatgggatc gaagtcgggc      1140
     ttctacatgc tgcgcgaccg gcggttcaaa tatgtccact acgtcgacca tcgcgcgcag      1200
     cttttcgatc ttgaggccga cccgcaggaa ctgaacgacc tcgcggacga tcccgccttt      1260
     tccgacgtgc gcgcgcagct taacgcccgc ctctgcgcca tctgcgatcc gaacgacacc      1320
     gatcggcgcg ccaaggcgcg ccaggccgag caactgcacc gcaatggcgg gcgcgaggcc      1380
     gtcatcgcca ggggagatct cggcttctcg ccaccgccag ggttctcgcc agacttcatg      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page