(data stored in ACNUC1104 zone)

EMBL: CP002026.PE540

CP002026.PE540       Location/Qualifiers
FT   CDS_pept        569662..570438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0544"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bbr:BB4313 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87877"
FT                   /db_xref="GOA:D7A457"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A457"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH87877.1"
FT                   /translation="MPVVTMERSFPLEAVRDLADRDVSGRAKYAVLTECLRTMILAGNL
FT                   PAGTRLPTERDLATLSGLSLGTVQRALRTLVEEGYLTRTPKLGSFVTERTQIRQPWHCR
FT                   FLAEDGRTVLPVSPTTRKRLVIEEVGPWTAHLGPAAAGYLYIERDFNVAGEFSVDSRFW
FT                   GDANRLSALRSGPVSQLDGENLKHLIASRCHLPVTHVIHKLRYARQGQEPARLILTALT
FT                   WSHEAPLYYQEFTIPPNSRELLVSDEIEQSAAFGIE"
     atgcccgttg tcaccatgga acgcagtttt ccgctcgaag ccgtccgcga cctcgcggat        60
     cgcgatgtct cgggcagggc caaatacgcc gtgctgaccg agtgcctgcg gacgatgatc       120
     ctcgccggca atctcccggc cggcacccgt cttcccaccg agcgcgacct cgcgacgtta       180
     agcgggctga gcctcggcac cgtgcagcgc gcgttgcgca cgctggtgga ggaggggtac       240
     ctgacccgca cccccaagct cggcagcttc gtcaccgagc ggacgcagat ccgccagccc       300
     tggcactgcc ggttcctggc ggaggacggc cggacggtgc tccccgtctc gcccacgacc       360
     cgcaagcggc tggtgatcga ggaggtcggc ccgtggaccg cgcatctcgg accggcggcc       420
     gcgggctatc tctatatcga gcgtgacttc aacgtcgccg gcgagttctc ggtcgacagc       480
     cgcttctggg gcgatgccaa ccgcctgtcg gcgctacgct cggggccggt ctcgcagctc       540
     gacggcgaga acctgaagca tctgatcgcc agccggtgcc acctgccggt cacccatgtg       600
     atccacaagc tgcgctatgc caggcagggg caggagccgg cccgcctcat cctgacggca       660
     ctgacatgga gccacgaggc gccgctctac taccaggagt tcaccatccc gcccaattcg       720
     cgcgaattgc tggtgagcga cgaaatcgag cagagtgcgg ctttcggcat cgaatag          777
//

If you have problems or comments...

PBIL Back to PBIL home page