(data stored in ACNUC1104 zone)

EMBL: CP002026.PE541

CP002026.PE541       Location/Qualifiers
FT   CDS_pept        complement(570495..570755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6181 putative type-I PKS"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87878"
FT                   /db_xref="UniProtKB/TrEMBL:D7A458"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87878.1"
FT                   /translation="MCDDCFDDEDAAPTDFPLVDIARAARMIERDIAGELAPEEAWAVY
FT                   FGEASGALDWRVLDRLARSVDAAKLLLSLSGAGRRPHLQPS"
     atgtgcgacg attgcttcga cgatgaggac gccgcgccga ccgatttccc tctcgtcgac        60
     atcgcgcgcg ccgcgcggat gatcgagcgc gacattgccg gcgaactcgc gccggaagag       120
     gcgtgggccg tctatttcgg cgaggccagc ggcgcgctgg actggcgcgt gctggaccgg       180
     ctggcgcgca gcgtcgacgc cgcgaagctg ctgctcagcc tgagcggtgc cggaaggcgg       240
     ccgcaccttc agccctccta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page