(data stored in ACNUC1104 zone)

EMBL: CP002026.PE542

CP002026.PE542       Location/Qualifiers
FT   CDS_pept        complement(570768..572054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0546"
FT                   /product="sigma-70 region 3 domain protein"
FT                   /note="PFAM: sigma-70 region 3 domain protein; KEGG:
FT                   bav:BAV1914 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87879"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A459"
FT                   /inference="protein motif:PFAM:PF04539"
FT                   /protein_id="ADH87879.1"
FT                   /translation="MNAHPPAAALRSANVTPLARLDIPGGGEVVLHRGHAFIGHMSPPL
FT                   GTSIYDLADPRKPRLVAQIAPKDGFSHTHKVKVAGDLMITNVERHRRHFYRKGERIEAV
FT                   TAELAAHLGRPPQEAEIAAALGVKEGDVADLRAGLARGYDDGGFRVWDIADPAHPRELA
FT                   YVKTGGIGVHRFDMEERYAYISTEMAGYVGNILVIYDLADPTRPREVSRWHLPGQHVSA
FT                   GETPTWSGQRHRLHHALRVGDVMWAACWYAGAYAIDVSDINRPHTIGSFNYHPPYPEPT
FT                   HTFFPLVQPLGGRNVALAIDEEHDHVPGQPHAFLWVLDIADLTKIAPISTFHVGEAASP
FT                   YATAGGRFGAHQFQERQVGSLVFATWFAGGLRVIDLADPTLPKEIGHFIPARASGHVAP
FT                   QSNDVDVNADGIVCLLDRDCGLDILQFEG"
     atgaacgcgc atccgccggc tgccgccctg cgcagcgcca acgtcacccc gctcgcccgg        60
     ctcgacattc ccggtggtgg cgaggtggtg ctgcatcgcg gccacgcctt tatcggccac       120
     atgtcgccgc cgctcggcac cagcatttat gacctggcgg atccgcgaaa gccgcgcctc       180
     gtcgcccaga tcgcgccgaa ggacggcttc tcccacaccc acaaggtgaa ggtcgccggc       240
     gacctgatga tcaccaatgt cgaacgccac cgccggcact tctaccgcaa gggcgagcgc       300
     atcgaggcgg tgacggcgga actggccgcg catcttgggc gcccgccgca ggaggcggag       360
     atcgccgccg cgctcggcgt gaaggaaggc gacgtcgccg acctgcgcgc ggggctggcg       420
     cgcggctatg acgacggtgg cttccgcgtc tgggacatcg ccgaccccgc ccatccgcgc       480
     gagctcgcct atgtgaagac cggcggcatc ggcgtgcacc gcttcgacat ggaagagcgc       540
     tacgcctaca tctccaccga gatggcgggc tatgtcggca acatcctcgt catctacgac       600
     ctcgccgatc cgacccgccc gcgcgaggtg tcacgctggc acctgccggg gcagcatgtg       660
     agcgccggcg agacgccgac atggtccggc cagcgccacc gcctgcacca cgcgctgcgc       720
     gtcggcgacg tgatgtgggc tgcctgctgg tacgccggcg cctatgcgat cgacgtgtcg       780
     gacatcaacc gtccgcacac catcggctcg ttcaactatc acccgcccta ccccgagccg       840
     acccacacct tcttcccgct ggtgcagccg ctcggcgggc gcaacgtagc cctcgccatc       900
     gacgaggagc acgaccacgt tcccggccag ccgcacgcct tcctgtgggt gctggacatc       960
     gcggacctga cgaagatcgc gccgatctcg accttccatg tcggcgaggc cgcctcaccc      1020
     tatgcgacgg cgggcgggcg cttcggcgcg caccagttcc aggagcggca ggtggggagc      1080
     ctcgtcttcg ctacttggtt cgccggcggg ttgcgcgtca tcgacctcgc cgacccgacg      1140
     ctgccgaagg agatcggcca tttcatcccc gcccgggcgt cgggtcatgt ggcgccacag      1200
     agcaacgacg tcgacgtgaa tgcggacggc atcgtctgcc tgctcgaccg cgactgcggc      1260
     ctcgacatcc tgcagttcga aggctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page