(data stored in ACNUC1104 zone)

EMBL: CP002026.PE545

CP002026.PE545       Location/Qualifiers
FT   CDS_pept        complement(574171..575172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dia:Dtpsy_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87882"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A462"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87882.1"
FT                   /translation="MTIMLDRRHVLMAGAGALAASLARPARAAGDFPDKPIQVLIPTGE
FT                   GGGVDQAARAFNRIWSKYLGANFEYSYFPGASGQVGYEVFISKRPADAYNILFGNIGPE
FT                   MIMYATQKVKYKYQEDFTYIGSMDIDDSVIWVGSSSKFKTIQELVEEGKKREITLSTSR
FT                   LPHPSTIGALALAEATGMKVRMIPYGGGGPARSAAITGEVDGCATFLSSSLGLGDQARF
FT                   LTVFNDTNRAPELTNNAPPVNQALGTKIPQMSGQRAIAIHTKAVEAYPDRVKKLTDSFK
FT                   QVFADPEYKTVAEKAGTPWEFIQYGDAASCQESAKEFVELADRFRSLLTATK"
     atgacaatca tgctcgacag gcgccatgtg ctcatggccg gggccggcgc gctcgcggcc        60
     tcgttggcgc gtcccgcgcg cgcagcaggc gactttccgg acaagccgat ccaggtgctg       120
     atcccgaccg gcgaaggcgg cggcgtcgat caggcggcgc gcgccttcaa ccgcatctgg       180
     tcgaaatatc tcggcgccaa tttcgagtat tcctacttcc ctggcgcctc gggccaagtc       240
     gggtacgaag tcttcatctc gaaacgcccc gcggatgcct acaacatcct cttcggcaat       300
     atcgggccgg agatgatcat gtacgccacc cagaaggtta agtacaaata tcaggaagac       360
     ttcacctata ttggcagcat ggacatcgac gattccgtca tctgggtcgg ctccagcagc       420
     aagttcaaga ccatccagga gctggtcgag gaaggcaaga agcgcgagat caccctttcg       480
     accagccgcc tgccgcatcc ctccaccatc ggcgcgctgg cgctggcgga ggccaccggc       540
     atgaaggtgc gcatgatccc ctatggcggc ggcgggcccg cccgctcggc ggcgatcacc       600
     ggcgaggtcg atggctgcgc caccttcctc tcctcctcgc tcggcctcgg cgaccaggcg       660
     cgcttcctca ccgtcttcaa cgacaccaac cgcgcgcccg agctcaccaa caacgccccg       720
     ccggtcaacc aggcgctcgg caccaagatc ccgcaaatgt ccggccagcg cgccatcgcc       780
     atccatacga aggcggtcga ggcctatccg gaccgggtga agaagctcac cgacagcttc       840
     aagcaggtct tcgccgatcc cgagtacaag accgtggcgg agaaggccgg cacgccgtgg       900
     gaattcatcc agtacggcga cgccgcctcc tgccaggaat cggcgaagga attcgtcgag       960
     ctcgccgatc gcttccgctc gctgctcacc gccacgaagt aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page