(data stored in ACNUC1104 zone)

EMBL: CP002026.PE546

CP002026.PE546       Location/Qualifiers
FT   CDS_pept        complement(575447..576514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0550"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   smd:Smed_5823 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87883"
FT                   /db_xref="GOA:D7A463"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR016846"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7A463"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADH87883.1"
FT                   /translation="MPDPVLIPARPGAIYRKQPRRSSSMSGDDHYLPLALINILGIAGI
FT                   VVWHLQGPSRPTGRLIVQILFFAGMSLVLYAGGIAPQQPDDVYTEGFAALLSKSARVLW
FT                   WTHLAWTIIGLIHIYVRLNRKPREAHLILDMAVAVIYLGVALSVMGFVFGMPVASLVTT
FT                   SGVVALILGLALQNTLGDVFSGIALTLGKAYAIGDWVQLSDGTAGRVTETNWRSTNLLT
FT                   AANNIVVLPNSMLARQGLTSLSRPDETHQITLGVRFAAVQSPRLIEEAMRSVLQASTRI
FT                   VQDPPPAVALKSIDAIAIDVELQFRVASLAVGTLAKNEIIDLIHGHRKADGLSLALPAQ
FT                   SLVFVPAPQATIVRL"
     atgcccgatc ccgtcctcat cccggctcgg ccgggggcga tctaccgcaa gcaaccccgg        60
     cgaagctctt ccatgtctgg cgatgaccac tacctgccgc ttgccctaat caacatccta       120
     ggcattgccg gcatcgtcgt ctggcacctt cagggcccca gccgccccac aggtcgcctt       180
     atcgtccaga tcctgttctt cgccggcatg agcctcgtcc tttatgcggg aggcatcgcg       240
     ccgcagcagc ccgacgacgt ctacacggag ggtttcgccg cgctgctgtc gaagtccgcc       300
     agggttcttt ggtggaccca cctcgcatgg acgatcatcg gcctcatcca catctatgtc       360
     cggctcaatc gcaagccgcg ggaagcgcat ctgatcttgg acatggccgt tgccgtgatc       420
     tatctcggcg tggcgctgtc ggtgatgggc tttgtcttcg gcatgcccgt cgcctccctg       480
     gtgacgacct cgggcgtcgt cgccctcata ttgggcctgg cgctacagaa cacgctcggc       540
     gatgtctttt ccggcatcgc gctgacactt ggcaaggcct atgcgatagg cgactgggtg       600
     cagctgagcg acggcacggc gggccgcgtc accgaaacca actggcgctc caccaatctg       660
     ctgaccgcgg cgaacaacat cgtcgtgctg cccaacagca tgctggcgag gcagggcctg       720
     accagcctca gccgtcccga cgagacgcat cagatcacat tgggcgtgcg cttcgccgcc       780
     gtgcagagcc cgcgcctcat cgaggaggcg atgcgaagcg tgctgcaagc cagcacccgc       840
     atcgtgcagg acccgccgcc ggccgttgcc ctgaagtcca tcgacgccat cgcgatcgac       900
     gtcgagctgc agttccgcgt cgccagcctc gctgtgggga cgctcgccaa gaacgagatc       960
     atcgacctca tccacggcca ccgcaaagca gacgggcttt ccctggcctt acccgcacaa      1020
     agcctcgtct tcgtaccggc accgcaggca acaattgtgc ggctttga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page