(data stored in ACNUC1104 zone)

EMBL: CP002026.PE547

CP002026.PE547       Location/Qualifiers
FT   CDS_pept        complement(576567..577484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0551"
FT                   /product="beta-lactamase-like protein"
FT                   /note="KEGG: mdi:METDI4456 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87884"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7A464"
FT                   /inference="similar to AA sequence:KEGG:METDI4456"
FT                   /protein_id="ADH87884.1"
FT                   /translation="MNLQNTAAPRRTGHEELVPSRYAVRVGEIDVLIVSDGVLPLPTKM
FT                   LGHNAEPAARAAWLNDMFLPTEAFDWALNVVVVRSGGQTILVDAGLGLDPDLNLPRAGQ
FT                   LIKRLAAVGIDLAAVTDVVLTHMHMDHVGGLLIDGVKERLRPDLRIHVAAAEVEFWKAP
FT                   DFSHVNMPAGFPDALRAAAKRFAKEYQSHLRLFDEEAEVAPGVVVSRTGGHTPGHSVVR
FT                   VASGGDRLMFAGDAVFAVGFEHPEWYNGFEHDPEEAARVRVRLLKELAATGSSLVATHL
FT                   PFPSVGHVAVEGDHFRWVPVFWDY"
     atgaacttgc aaaacaccgc cgccccccgt cgaacgggac atgaagagct ggtgccgtcg        60
     cgttacgcgg tgcgggtcgg cgagatcgac gtgctgatcg tcagcgacgg cgtcctgccg       120
     cttccgacca agatgctggg acacaacgcc gagcccgcgg cacgagcggc ctggctgaat       180
     gacatgttcc tgccgaccga ggctttcgac tgggcgctga acgtggtcgt ggtccgcagc       240
     ggcgggcaga ccattctcgt cgatgccggg ctcggcctcg atccggacct gaacctgccg       300
     cgggccgggc agctgatcaa gcggctcgcg gctgtcggca tcgacctggc ggccgtgacc       360
     gacgtggtcc tgacccacat gcacatggat catgtcggcg ggctgctgat cgacggagtg       420
     aaggagcgcc tgcgtccgga tctgcggatc catgtggccg ccgccgaggt cgagttctgg       480
     aaggcgcccg atttctccca cgtcaacatg ccggcggggt tcccggacgc gcttcgagcc       540
     gccgcgaagc ggttcgcgaa agagtatcag agccatctgc ggctgttcga tgaggaggcc       600
     gaggtggcgc cgggcgtggt cgtctctcgc accggcgggc acacccccgg ccacagcgtg       660
     gtccgcgtgg cgtccggcgg cgaccggctt atgttcgccg gcgacgccgt gttcgcggtc       720
     gggttcgaac accccgaatg gtacaacggc ttcgaacatg accccgaaga agcggcccgc       780
     gtccgggtcc gtcttttgaa ggagctggcg gcgaccggat catcgctcgt ggccacccac       840
     ctgccgttcc cgtccgtcgg ccatgtggcg gtcgagggcg accacttccg ctgggtgcct       900
     gtcttctggg actactga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page