(data stored in ACNUC1104 zone)

EMBL: CP002026.PE548

CP002026.PE548       Location/Qualifiers
FT   CDS_pept        complement(577603..578808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0552"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bja:bll2792 putative dehydrogenase,
FT                   oxidoreductase FAD flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87885"
FT                   /db_xref="GOA:D7A465"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A465"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH87885.1"
FT                   /translation="MRLVIIGAGFAGMYAALSAARLRNLQGVSPEELEIELVAPQPTLV
FT                   VRPRLYEPKPETLTAPLLPVLEEIDVRYVQGTAETVDTRSNSVGIVTGGGERRTLAYDR
FT                   LVLATGSRLFRPDIPGVAEHVFSVDQLDDAVALDRHLHALARRPASAARDTVVVAGGGF
FT                   TGIEAATEMPARLRTILGDKAGIRVVIVDRNDAIAPDMGAGPRPVIENALRKVGVETRL
FT                   GAGVAAVDADGVTLAGGERIESATVIWAAGMRAAPLTQQIPAERDNSGRLLVDRALRVP
FT                   GVGGVFATGDAAKAACDDIGNYALMSCQHATRMGAFAGHNAAAELLGVPTIAYHQEAYV
FT                   TCLDLGDAGALFTRGWDRQVEFVGAEAKKMKQEINTVWIYPPRAQRNVALASAEPERVT
FT                   DL"
     atgcgactgg tcatcatcgg cgccggcttc gccggcatgt atgccgccct ttccgccgcg        60
     cgcctgcgca atctccaggg cgtctcgccc gaggagctcg agatcgagct ggtggcgccg       120
     cagccgacgc tggtggttcg cccgcggctc tacgaaccca agcccgagac gctgacggcg       180
     ccgctcctgc cggtgctgga ggaaatcgac gtccgctatg tgcagggcac cgccgagacg       240
     gtcgacacac ggtccaattc ggtgggcatc gtcaccggtg gcggcgagcg caggacgctt       300
     gcctatgacc ggctggtgct cgccaccggc agccggctgt tccgcccgga cattcccggc       360
     gtcgccgagc atgtgttcag cgtcgaccaa ctcgacgacg cggtcgccct cgaccgccat       420
     ctccacgcgc tggcgcgccg gccggcgtcg gccgcccgtg acacggtggt cgtcgccggc       480
     ggcggcttca ccggcatcga ggcggcaacc gaaatgccgg cgcggctgcg gaccattctc       540
     ggcgacaagg ccggcatccg cgtcgtcatc gtcgaccgta acgacgccat cgcacccgat       600
     atgggcgccg ggccgcgccc ggtcatcgag aacgccctgc gcaaggtggg tgtggagacc       660
     cggctcggcg ccggcgtcgc tgcggtggat gcggacggcg tgacgctcgc cggcggcgag       720
     cgcatcgaga gcgccactgt gatctgggct gccggcatgc gcgccgcgcc gctgacccag       780
     cagatcccgg ccgagcgcga caattccggc cggctgctcg tcgaccgcgc cctgcgcgtg       840
     ccgggcgtcg gcggcgtctt cgccaccggc gatgccgcca aggcggcgtg cgacgacatc       900
     ggcaactacg cgctgatgtc ctgccagcac gccacccgca tgggcgcctt cgccggccac       960
     aacgccgccg ccgagctgct gggcgtgccg accatcgcct accaccagga ggcctatgtg      1020
     acctgcctcg acctcggcga cgccggcgcg ctgttcacgc gcggctggga ccgtcaggtc      1080
     gagttcgtcg gcgccgaggc caagaagatg aagcaggaga tcaacacggt gtggatttac      1140
     ccgccccgtg cccagcgcaa cgtcgctctc gcctcggcgg aacccgagcg cgtcaccgac      1200
     ctctag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page