(data stored in ACNUC1104 zone)

EMBL: CP002026.PE55

CP002026.PE55        Location/Qualifiers
FT   CDS_pept        complement(43695..44594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0055"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mno:Mnod_0259 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87392"
FT                   /db_xref="GOA:D6ZZX8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87392.1"
FT                   /translation="MIDRFELLLALAKERHFGRAAESCGVTQPTLSAGLKQLEEQLGVR
FT                   LVERGSRFIGFTPEGERALQWARRVIGDVRAMRQEIAGMRKGLSGHLRIAGIPTAMPML
FT                   SELTTPFHEKHGDVRFTLMSASSNEVLRLIENLEADAGVTYLDNDPLGRVKTVPLYQEG
FT                   YRFLTAVDAPLGDRAKVTWEEIGQVPLCLLTPDMQNRRIVDKQLTEAGHAVVPMLEANS
FT                   TLALLSHVRTGKWASVVANTLADVFAFPENIRSIPIEGPEVLHQMGLVVLDREPLTPIV
FT                   TALMAEARAIAPELAARM"
     gtgatcgacc gtttcgaact tctgctcgcc ctcgccaagg agcgccattt cggccgtgcc        60
     gccgagtcct gcggcgtcac ccagcccacc ctttccgccg gcctcaagca gctcgaggag       120
     cagctcggcg tgcgcctcgt cgagcgcggc tcgcgcttca tcggcttcac gccggagggc       180
     gagcgggcgc tgcaatgggc gcggcgggtg atcggcgacg tgcgcgccat gcggcaggag       240
     atcgccggca tgcgcaaggg cctcagcggc catctgcgca tcgccggcat cccgaccgcc       300
     atgccgatgc tctccgagct gacgacgccc ttccacgaga agcatggcga cgtgcgcttc       360
     acgctgatgt cggcctcctc caacgaggtg ctgcggctga tcgagaatct cgaggccgat       420
     gccggcgtca cctatctcga caacgacccg ctcggccggg tgaagacggt gccgctctat       480
     caggaaggct accgcttcct caccgccgtc gacgccccgc tcggcgaccg cgccaaggtg       540
     acgtgggagg agatcggcca ggtgccgctc tgcctgctca cccccgacat gcagaaccgc       600
     cgcatcgtcg acaagcagct caccgaggcc ggccacgccg tggtgccgat gctggaggcg       660
     aactcgacgc tcgctttgct ctcgcatgtg cgcaccggca aatgggcgag cgtcgtcgcc       720
     aacacgctgg ccgacgtctt cgccttcccg gagaatatcc gctcgatccc gatcgagggg       780
     ccggaggtgc tgcaccagat gggcctcgtc gtgctcgacc gcgagccgct gacccccatc       840
     gtcaccgcgc tgatggcgga agcccgcgcc atcgccccgg agctcgcggc gcggatgtga       900
//

If you have problems or comments...

PBIL Back to PBIL home page