(data stored in ACNUC1104 zone)

EMBL: CP002026.PE550

CP002026.PE550       Location/Qualifiers
FT   CDS_pept        complement(579975..580925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0554"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bja:blr5120 transcriptional regulatory
FT                   protein; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87887"
FT                   /db_xref="GOA:D7A467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D7A467"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADH87887.1"
FT                   /translation="MDDTILRVPSLEDLFRTSEPIQEQPWTGARPTADEMARVLGTTPR
FT                   RIVTELSGSSIAHWNHGELHDVVEPMKDHVIMTYIGTMQRLERRTGRSLASGTARPGVV
FT                   TIIPSGTSSRWDIGGAVDVLQLYLPHAILERVAAEADTSGPAPLLERTGHLDPTTSRLL
FT                   MSASEVLDGSEALDALFRQQLTELLATRLLSAHTGAGASLQLALGGLAPTALRRAIERL
FT                   RSDDDADLSLAALAADAHLSRFHFCRAFKQSTGLSPHAWLRQHRLAQAMTMLRDTDESV
FT                   VSIAVTLGYGSQSAFAAAFRRLTGETPSDWRRRAR"
     atggacgata ccatcctgcg cgtgccctcg ctggaggatc tgttccgcac ctccgaaccc        60
     atccaggaac agccatggac cggcgcccgg cccacggcgg acgagatggc gcgcgtcctc       120
     ggcaccacgc cgcgccgcat cgtcaccgaa ttgtccggca gttccatcgc ccattggaat       180
     cacggcgagc tgcacgatgt cgtcgagccg atgaaggacc atgtcatcat gacctatatc       240
     ggcacgatgc agcgcctgga gcgccggacg gggagatcgc tcgcatccgg gacggcgcgg       300
     ccgggcgtgg tgacgatcat cccctccggc accagctcgc gctgggacat cggcggagcg       360
     gtcgacgtcc tccagctcta tctgccgcat gccatattgg agcgcgtcgc cgccgaagcc       420
     gatacgtccg gccccgcgcc gctgctggaa cgcaccggcc atctcgaccc gacgacgtcg       480
     cggctgctga tgagcgcctc cgaggtgctc gacggcagcg aagccctcga tgccctgttc       540
     cggcagcagc tcaccgagct tctggcgaca cggctcctgt ccgcgcatac cggtgccggc       600
     gccagcctcc agctggcatt gggcgggctg gcgccgacgg cgctgcgccg cgccatcgaa       660
     cgactgcgct cggatgacga cgccgacctg tcgctcgccg ccctcgccgc ggacgcgcat       720
     ctgtcgcgct tccatttctg ccgcgccttc aagcagagca ccgggctttc gccgcatgcc       780
     tggctgcggc agcaccggct ggcgcaggcg atgacgatgc tgcgcgatac cgacgagtcg       840
     gtggtctcga tcgcggtgac gctcggctac ggctcgcaat ccgccttcgc cgccgccttc       900
     cggcgcctga ccggagagac cccgagcgat tggcgccggc gggcgcgtta g                951
//

If you have problems or comments...

PBIL Back to PBIL home page