(data stored in ACNUC1104 zone)

EMBL: CP002026.PE551

CP002026.PE551       Location/Qualifiers
FT   CDS_pept        581144..582721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0555"
FT                   /product="transcriptional regulator domain protein"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: oca:OCAR_6759 transcriptional regulator, CadC-family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87888"
FT                   /db_xref="GOA:D7A468"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7A468"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADH87888.1"
FT                   /translation="MKYHFADCVLDLDRRELTRASQSVAVGPQVFDLLVHLVENHERVV
FT                   SKDGLLDAVWNGRIVSESTLTSHINAVRKAIGDSGAEQRLVRTVARKGFRFVGDIQQVG
FT                   MSEASRDAAIMPEIAIPATAVTAHKPSIAVMPFQNLSGDPEQDYFADGVAEEIITALSR
FT                   VRWLFVIARNSSFAYRGRAADVQQISRELGVTYVLEGSVRKAADRIRITGQLVNASTNG
FT                   YLWADRFEGALDDIFTLQDRISGNVVGAIAPQMELAEIERARRKPTENLSAYDCYLRGL
FT                   AHLHRGGRESVEEALPLFRKAIELDGEFAPPYAMAAWGYFWRKVNGWTIDPVQETAEGI
FT                   ALARRGVELGRDDAVVLARAGHALAHLAGEFESGIGLLDRALFLNPNLAPAWFLGGFLR
FT                   VWHGEPEAAIDYFEHAMRLSPVDPELYRMQAGIAMAHLFAGRFETASLWADQAQRNLPS
FT                   FLMAVATGAASQALSGRTEEARRTMDQLRELAPALHISGLKDWLPIRRQEDFALFADGL
FT                   RQAGLPDK"
     ttgaagtatc atttcgcgga ctgcgtgctc gaccttgacc gacgggagct gactcgcgcg        60
     tcgcagtcgg tcgcggtcgg accgcaggtc tttgatctct tggtgcatct cgtcgagaat       120
     cacgaacggg tggtgagcaa ggacggcctg ctcgatgcgg tctggaacgg ccgcatcgtt       180
     tccgaatcca ccctgaccag ccacatcaac gcggtgcgca aggcgatcgg cgacagcggc       240
     gccgagcagc gcctcgtgcg caccgtcgcg cgcaagggtt tccgcttcgt cggcgacatc       300
     cagcaggtcg ggatgtcgga ggcgtcacgc gacgccgcga tcatgccgga gatcgccatc       360
     cccgcgacgg ccgtgaccgc gcacaagcct tccatcgcgg tgatgccgtt ccagaatctc       420
     agcggcgatc cggagcagga ctatttcgcc gacggggtgg cggaggagat catcacggcg       480
     ctctcgcgcg tgcgctggct gttcgtcatc gcgcgcaatt cgagcttcgc ctatcgcggc       540
     cgcgccgccg acgtgcagca gatcagccgc gagctgggcg tcacctacgt tctcgaaggc       600
     agcgtgcgca aggcagccga ccgcatccgc atcaccggcc agctcgtcaa tgccagcacc       660
     aatggctatc tctgggccga ccgcttcgag ggtgccctcg acgatatctt cacgctgcag       720
     gaccgcattt ccggcaatgt cgtcggcgcc atcgccccgc agatggaatt ggcggagatc       780
     gagcgcgcgc ggcgcaagcc caccgagaac ctcagcgcct atgactgcta tctgcgcggc       840
     ctcgcgcatc tgcaccgcgg cggccgggaa tcggtcgagg aggcgctgcc gctgttccgc       900
     aaggcgatcg agctcgatgg cgagttcgcg ccgccttacg caatggcggc gtggggctat       960
     ttctggcgca aggtcaatgg ctggacgatc gatccagtgc aggagacggc cgagggcatc      1020
     gcccttgccc gccgcggcgt ggagctcgga cgggacgacg cggtggtgct ggcgagggcc      1080
     ggccatgcgc tcgcccatct cgccggcgag ttcgagagcg gcatcggcct cctcgaccgc      1140
     gcgctgttcc ttaatcccaa tttggcgccc gcctggtttc tcggcggttt cctgagggtc      1200
     tggcacggcg agccggaggc ggcgatcgac tatttcgagc acgctatgcg cctgagccct      1260
     gtcgatcccg agctctaccg gatgcaggcc gggatcgcga tggcgcatct cttcgccggc      1320
     cgtttcgaga ccgcgtcgct atgggcggac caggcccagc ggaacctgcc gagcttcctc      1380
     atggccgttg ccaccggcgc ggcgagccag gcgctgtcgg gccggaccga ggaagcccgc      1440
     cggaccatgg atcaattgcg ggagcttgcc cccgctctgc acatttccgg cctgaaggac      1500
     tggctgccga tccgccgaca ggaagatttc gccctgttcg ccgacggcct gcgccaagcc      1560
     ggccttcccg acaagtga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page