(data stored in ACNUC1104 zone)

EMBL: CP002026.PE553

CP002026.PE553       Location/Qualifiers
FT   CDS_pept        complement(583947..584876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0557"
FT                   /product="endoglucanase family protein"
FT                   /note="KEGG: oan:Oant_4412 endoglucanase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87890"
FT                   /db_xref="GOA:D7A470"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:D7A470"
FT                   /inference="similar to AA sequence:KEGG:Oant_4412"
FT                   /protein_id="ADH87890.1"
FT                   /translation="MRPLSKKAYVAAVSGLMTLAAAVTLVAPGLSQTAPRPTAKPADQV
FT                   KFGVYDPEGVFAGDKSVGIEHVYIPWRDSDPTSLAKADAYAREHRRDLMVTVEPWSWSP
FT                   GTNVSGEQLLHGILAGAYDGPAKAVCGEIGKLDRPVTIRWGHEMDLPNGHFPWSSWAPD
FT                   DYVAAYRHFVSQCRIDAPQARFMWSPRGEERLAAYYPGDAYVDEVGLTVLDLQQYDIDQ
FT                   YGHARSFSEALRPAYDRVVGFGKPIVVAELGFQGDSAFMEQWLQDVRTVGGEFPQLAAV
FT                   VYFNAVDPYAWPEPYGRPDWRLQRGFVN"
     atgagacctc tgtccaagaa ggcttatgtt gctgcggtgt ccggcctgat gacactggcg        60
     gcggcggtca cgctcgtcgc accaggtctg tcccagaccg ccccgcggcc gaccgcgaag       120
     cccgccgacc aggtgaagtt cggcgtctat gaccccgagg gcgtcttcgc gggcgacaag       180
     agcgtcggca tcgagcacgt ctacatcccg tggcgcgatt ccgacccgac ctcgctggcg       240
     aaggcggacg cctatgcgcg cgagcaccgt cgcgacctga tggtcaccgt cgaaccctgg       300
     tcctggtcgc cggggacgaa cgtctccggt gagcaattgc tgcacggcat cctcgccggc       360
     gcctatgacg gtccggcaaa ggccgtctgc ggcgagatcg gcaagctcga ccgccccgtg       420
     accatccgct ggggtcacga gatggatctg cccaacggcc acttcccctg gtcgagctgg       480
     gcgccggacg actatgtcgc ggcctatcgg cacttcgttt cgcaatgccg gatcgacgcg       540
     ccgcaggccc gcttcatgtg gtcgccgcgc ggcgaggagc gcctcgccgc ctattatccc       600
     ggcgatgcct atgtcgacga ggtcggcctg accgtgctcg accttcagca gtacgacatc       660
     gaccagtacg gccatgcgcg cagcttcagc gaggcgctcc ggcccgccta tgaccgcgtc       720
     gtcggcttcg gcaagcccat cgtggttgcc gagctgggct tccagggcga cagcgcgttc       780
     atggaacagt ggctccagga cgtgcgcacc gtgggaggcg aattcccgca gctggccgcg       840
     gtcgtctact tcaacgccgt cgatccgtat gcctggccgg agccctatgg acgccccgac       900
     tggcggctgc agcgcggctt cgtgaactga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page