(data stored in ACNUC1104 zone)

EMBL: CP002026.PE554

CP002026.PE554       Location/Qualifiers
FT   CDS_pept        complement(584896..586287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0558"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; KEGG:
FT                   oan:Oant_4414 UDP-glucose 6-dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87891"
FT                   /db_xref="GOA:D7A471"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A471"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADH87891.1"
FT                   /translation="MKVAVIGTGYVGLVAGVCFADMGNRVVCVDTNAATVEKLRAGRSP
FT                   IYEPGIEELLRRNIAAGRLTVTTQAREALDGTEAAFICVGTPPRDSDGEPDLSLVYGAA
FT                   KDIANAMTGPLTVVVKSTVPVGTGDAVEEIIRRTRPDMSFSVASNPEFLREGSALADFQ
FT                   SPDRIVFGVEDAKAEETLRKLYLPLRATGAPQIVTRRRTSELIKYAANAFLATKISFIN
FT                   EMADLCEKVEGDVTELAAAVGLDSRIGGAFLRAGPGYGGSCFPKDTCALLHTAQEYGVP
FT                   LRVVEGTVAANNARKHRMAQKVIEAAGGSVIGMKIAVLGLTFKPDTDDMRDAPSIPLIR
FT                   HLQRAGAEIAAYDPQGLRQARDRLGNVAFHGDPYECAADADVVVLMTEWNELRSLDLGR
FT                   LHRIMRTPVMVDLRNIYPPELARRFGFRLVNIGRPGPRGTVHQLPPALVASPPIQSDAA
FT                   PILVK"
     atgaaagtcg cagtcatagg aaccggctat gtcggcctgg tcgccggcgt gtgctttgcc        60
     gatatgggca accgcgttgt ctgcgtcgat acgaacgcgg ccacggtgga aaagctgcgc       120
     gccggcagga gcccgatcta cgagccgggc atcgaggagc ttctccggcg caacatcgcc       180
     gcgggccgcc tcaccgtcac cacccaggcc cgcgaagccc tggacggcac ggaagccgcg       240
     ttcatctgcg tcggcacccc gccgcgggac agtgacggcg agcccgatct ctcgctcgtg       300
     tacggcgcgg cgaaggacat cgccaatgcc atgacgggtc cgctcaccgt ggtcgtcaaa       360
     tcgaccgtgc cggtgggcac cggcgacgcg gtcgaggaga tcatccggcg gacgcgtccc       420
     gacatgtcgt tttcggtcgc ctcgaacccc gaattcctgc gcgaggggtc cgccctcgcc       480
     gacttccagt ctcccgaccg gatcgtgttc ggcgtcgagg acgccaaggc ggaggaaacg       540
     ctgcgcaaac tctatctgcc gctgcgtgcc accggtgcgc cgcagatcgt cacccgccgg       600
     cgcacctccg agctgatcaa gtacgccgcc aacgcctttc tcgccaccaa gatcagcttc       660
     atcaacgaga tggccgacct gtgcgagaag gtcgagggcg acgtgaccga actcgccgcc       720
     gccgtcgggc tcgacagccg catcggcggt gccttcctgc gcgccgggcc cggctatggc       780
     gggtcctgct tcccgaaaga cacctgcgcc ctgctgcaca ccgcgcagga atacggcgtg       840
     ccgctgcggg tggtcgaagg caccgtcgcc gccaacaacg cccgcaagca ccgcatggcg       900
     cagaaggtga tcgaggcggc cggcggctcg gtgatcggca tgaagatcgc agtgctcggc       960
     ctgaccttca agccggacac cgacgacatg cgcgacgcgc cgtcgatccc gctgatccgc      1020
     cacctgcagc gcgcgggcgc cgagatcgcg gcctacgacc cgcagggcct gcggcaggcg      1080
     cgcgaccggc tgggcaacgt ggcgtttcac ggcgatccct atgaatgcgc cgccgatgcc      1140
     gacgtggtcg tgctgatgac cgaatggaac gagctgcgct cgctcgacct cggccgcctg      1200
     caccggatca tgcgcacccc cgtcatggtc gatctgcgca acatctatcc gccggagctc      1260
     gcccgtcgct tcggcttccg cctggtgaac atcggccgcc ccggtccccg cggcaccgtc      1320
     caccagctgc cgccggcgct cgtcgcctca ccgccgatcc agagcgatgc ggctccaatc      1380
     ctcgtcaaat ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page