(data stored in ACNUC1104 zone)

EMBL: CP002026.PE555

CP002026.PE555       Location/Qualifiers
FT   CDS_pept        complement(586284..588227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0559"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   smd:Smed_3671 putative cellulose synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87892"
FT                   /db_xref="GOA:D7A472"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7A472"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADH87892.1"
FT                   /translation="MNEVPPLILSAADDRPEAFADRRRYNRPRAALVPLLSPPQRVELF
FT                   LAISAWTAAYLFFWLWWLDPAHITSVGRFIFASLPFAWLTLMPIYFFTVFVGSRKPAGL
FT                   AQLPEGSTVAMVVTKAPSEPFEVVARTLEAMIAQPYPHDTWLADEDPSAETLDWCATHG
FT                   VRVSTRRGVDDYQREEWPRRVRCKEGNLAYFYDHFGYRLYDFVVQMDADHVPSRHYLER
FT                   MLAPFSDPRIGYVSAPSICNRNAGESWAARARLYAEASMHGPLQAGYTGGWAPLCIGSH
FT                   YAVRTEALETIGGLGPELAEDHSTTLMMNAGGWRGVHAIDAIANGDGPRSFADLATQEF
FT                   QWARSLVTILLRYSPALVPLLPARLRFQFLFCQLWYPLYSSIWAVLFLMPVVALASREH
FT                   FADVTYYDFVVHYAPMSVVLLCMIYRWRAGGWLRPANARVLSWEEILFVLAKWPWSLLG
FT                   TIYALRDFFTGSFVDFRVTPKGKGTVEPVPLRVVAPYVAISLGSAAPVLLLDDAGPASG
FT                   FYIFAIVNAVLYAVLVLVILVRHRIENPEGRGPRGRRPMEVGLVAALLALPLTAAVQRG
FT                   PEGLGALAWGALPVSYTYTVFSAAGAGLGYGTRKLIFVMPWAERPQQGTPSPSVDQQAD
FT                   QSPHRRNSGRTQ"
     gtgaacgagg tccctcccct catcctctcg gcagcggacg accggcccga agccttcgcc        60
     gaccggcggc gctacaaccg tccgcgcgcg gcgctcgtgc cgctcctctc gccgccgcag       120
     cgggtcgagc tgttcctcgc catttccgcg tggaccgccg cctatctctt cttctggctt       180
     tggtggctcg accccgccca tatcaccagc gtcggacgct tcatcttcgc gagcctgccc       240
     ttcgcctggc tgacgctgat gccgatctac ttcttcacgg tcttcgtcgg cagccgcaaa       300
     ccggccggcc tcgcgcagct gccggagggc agcaccgtcg ccatggtggt gacgaaggcg       360
     ccgtccgagc cgttcgaggt cgtggcgcgc acgctcgaag ccatgatcgc gcagccctac       420
     ccccacgaca cctggctggc ggacgaggat ccctcggccg aaaccctgga ctggtgcgcg       480
     acgcacggcg tccgggtctc gacgcgcagg ggcgtcgacg actatcagcg ggaggaatgg       540
     ccgcgccggg tgcgctgcaa ggaaggcaac ctcgcctatt tctacgatca tttcggctac       600
     cggctgtacg acttcgtcgt ccagatggac gccgatcatg tgccgagccg gcactatctc       660
     gagcgcatgc tcgcgccctt cagcgatccg cggatcggtt atgtatcggc gccgagcatc       720
     tgcaaccgca atgccggtga gagctgggcg gcgcgcgcgc gcctctacgc cgaagcgtcg       780
     atgcacggcc cgcttcaggc cggctacacg ggcggctggg cgccgctgtg cattggctcg       840
     cactatgcgg tgcgcaccga ggcgctggag accattggcg ggcttggccc ggaactggcc       900
     gaggaccatt ccaccacgct gatgatgaac gccggcggct ggcgcggcgt ccatgccatc       960
     gatgccatcg ccaatggcga cggcccgcgc agcttcgcgg atcttgcgac gcaggagttc      1020
     cagtgggcgc gcagcctggt caccatcctg ctgcgctact cgcccgcgct cgtgccgctg      1080
     ctgcccgcgc gcctgcgctt ccagttcctg ttctgccagc tctggtatcc gctctattct      1140
     agcatctggg ccgtgctctt cctgatgccg gtggtggccc tcgccagccg cgagcatttc      1200
     gccgacgtca cctattacga cttcgtcgtg cactacgcgc cgatgtctgt ggtgctgttg      1260
     tgcatgatct atcgctggcg ggccggcggc tggctgcgcc cggcgaatgc acgggtgctc      1320
     agctgggagg agatcctctt cgtcctcgcg aaatggccct ggtcgctgct cggcacgatc      1380
     tacgcgctgc gcgacttctt caccggctcc ttcgtcgatt tccgtgtcac accaaagggg      1440
     aagggaacgg tcgagcccgt gccgctgcgc gtggtcgccc catatgtggc gatctcgctc      1500
     ggatcggccg cgccggtgct gctgctggac gatgccgggc cggcgagcgg cttctacatc      1560
     ttcgccatcg tcaacgcggt gctctacgcc gtcctggtcc tcgtcatcct ggtgcgtcac      1620
     cggatcgaga acccggaagg ccgaggcccg cgcggccgca ggccgatgga ggtcgggctc      1680
     gtcgccgcgc tgctcgcgct gcctctcacg gccgccgtcc agcgcgggcc ggaaggtctc      1740
     ggcgccctcg cctggggcgc cctgccggtc tcgtacacct acaccgtctt ttccgccgcc      1800
     ggggctggcc tcggctacgg cacccgcaag ctcatcttcg tgatgccctg ggccgagagg      1860
     ccccagcagg ggaccccgtc cccgtccgtc gaccaacagg ccgaccaatc gccgcacagg      1920
     cgcaattctg ggagaacgca atga                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page