(data stored in ACNUC1104 zone)

EMBL: CP002026.PE556

CP002026.PE556       Location/Qualifiers
FT   CDS_pept        complement(588224..589210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0560"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="KEGG: bov:BOV_A0474 UDP-glucose 4-epimerase;
FT                   TIGRFAM: UDP-glucose 4-epimerase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87893"
FT                   /db_xref="GOA:D7A473"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A473"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ADH87893.1"
FT                   /translation="MNAPRILVTGGAGYIGSHACKALAANGFRPVAFDNLSLGHRDAVR
FT                   WGPFVHGDILDTQRLAEAMRAHGISAVIHFAALAYVGESVSIPARYYRTNVGGTLSLLE
FT                   ACRLAEVRHLVFSSSCATYGIPDHLPVSESAEQCPINPYGRTKLVAEEMLADEANANGL
FT                   HFAILRYFNAAGADPQLELGERHDPETHVVPLAIMAALGQAGPLAIYGDDYPTADGTCV
FT                   RDFVHVSDLAEAHVRALDHLLSGGHNLTANLGSGTGTSILQLIRAVERQMNCGVPIHVA
FT                   PRRSGDPPALYADITRARDLLGFAPRHSDLDAIVATAVRYHANGGLS"
     atgaacgcgc cccgtatact cgtcaccggc ggagccggct acatcggcag ccacgcctgc        60
     aaggcgctcg cggccaacgg cttccgcccg gtcgccttcg acaatctgtc cctcggccac       120
     cgcgacgcgg tgcggtgggg ccccttcgtg catggcgaca tactcgatac gcagaggctg       180
     gccgaggcga tgcgcgccca cggcatcagc gccgtcatcc acttcgcggc gttggcctat       240
     gtgggcgagt cggtatcgat ccccgcgcgc tactaccgca ccaatgtggg cggcacgctg       300
     tcgctgctcg aggcatgccg gctcgcggag gtgcgccacc tcgtcttctc cagttcctgc       360
     gccacctacg gcatcccaga tcacctcccc gtctcggaga gcgccgagca atgcccgatc       420
     aacccctacg gtcggaccaa gctcgtggcg gaagaaatgc tcgccgacga ggcgaatgcg       480
     aacgggctgc acttcgccat cctgcgctac ttcaatgctg ccggcgccga cccccagctc       540
     gaactcggcg aacggcacga tcccgagacc cacgtcgtgc ccctggcgat catggctgca       600
     ctgggccagg ccgggccgct ggcgatctac ggcgacgact acccgaccgc cgacggcacc       660
     tgcgtgcggg atttcgtcca tgtgagcgat ctcgccgaag cccatgttcg cgcgctcgac       720
     cacctgctga gcggcggcca caatctcacg gccaatctgg gctcgggcac gggaacctcg       780
     attctccagc tgatccgcgc tgtcgagcgc cagatgaact gcggcgtgcc gatccacgtc       840
     gcgccgcggc gtagcggcga tccgcccgcc ctctatgccg acatcacgcg ggcgcgcgac       900
     cttctcggct tcgcgccccg ccattcggac ctcgacgcga tcgtggccac cgccgtgcgc       960
     tatcatgcca atggggggct ctcgtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page