(data stored in ACNUC1104 zone)

EMBL: CP002026.PE558

CP002026.PE558       Location/Qualifiers
FT   CDS_pept        complement(590642..591994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0562"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: bbt:BBta_3472 signal transduction histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87895"
FT                   /db_xref="GOA:D7A475"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A475"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87895.1"
FT                   /translation="MSLGSRSWSLKRRLATRLLVVLAIAVLGPPIAFLFFSWWTVGSLH
FT                   HRALQDQAADIVRGLDTRVTPPVLTLPEVLAAAYTRSNDSYFYLVLERDGTVVTASSPL
FT                   AASLATNATIVPPGEFFLVPRAGGAPWYTYSTNADGYRIVVAQDSSHENVLFDSIVREV
FT                   AGFTLWLALPLLLVALLVMMHTLNRAFRPIARAAEDARTITPGGQEAQISAHGLPREIT
FT                   PLVKAVNAALARLARAYDVERRFTTDAAHELRTPVAVLMARIDMLPEGPAKESLVLDTA
FT                   RLSRSVSQLLQVARLDAKPLAIDEDIDLARVVRHAVALLGPLAMQDGRRMEMTAPNRPI
FT                   MVRGNAQAIALAVTNLVENALSHTPAGTPIDVQVTSEPAIYVLDRGQGVPPDERMAIFE
FT                   RFQRSPNTASSGTGLGLAIVAEIAARHHAVASVEARAGGGSIFAIRWINSA"
     gtgagcctcg gttcgcgctc gtggtctctg aagcgccggc tggcaacgcg gttgcttgtc        60
     gtgctcgcca tagccgtgct cggcccgccg atcgccttcc tcttcttctc ttggtggacc       120
     gtcggctcgc tgcaccatcg ggcattgcag gaccaggccg ccgacatcgt gcgcggcctc       180
     gacacccgcg tcacgccgcc cgtgctgacg ctgccggagg tgctcgccgc cgcgtatacg       240
     cgttccaatg attcctattt ctacctcgtg ctggagcgcg acggcacagt cgtcaccgca       300
     tcgtcgccgc tggccgcgtc cctggctacc aatgccacga tcgtcccgcc gggggagttc       360
     ttcctcgtgc cccgtgcggg aggcgccccc tggtacacct attcgacgaa cgccgacggc       420
     tatcgcatcg ttgtcgccca ggacagctcg cacgagaacg tcctcttcga cagcatcgtc       480
     cgcgaagtcg cggggttcac gctgtggctc gcgctgcccc tgctgctggt ggcgctgctc       540
     gtgatgatgc acacgctcaa ccgggccttc cgtccgatcg cgcgagcggc ggaagatgcg       600
     cggacgatca cgcccggggg acaggaggcg cagatctcgg cccacgggct gccgcgcgag       660
     atcacgcccc tcgtcaaggc ggtcaacgcc gcactggctc ggttggcccg cgcctatgac       720
     gtcgagcggc gcttcaccac cgatgcggcg cacgaactgc gcacgccggt agccgtgctc       780
     atggcacgca tcgacatgct gccggaggga ccggcaaagg aaagcctcgt cctggacacg       840
     gcccgtctca gtcgatccgt ctcccagctg ctgcaggtgg caaggctgga cgccaagccg       900
     ctggcgatag acgaggacat cgatcttgcc agggtggtgc gccacgcggt ggcgttgctc       960
     ggcccgctgg cgatgcagga cgggcgccgc atggaaatga cggcgcccaa tcgaccgatc      1020
     atggtccgtg gcaacgcgca ggcgattgcg ctggcggtca ccaacctcgt ggagaacgcg      1080
     ctctcgcata cgccggcggg aacgccgatc gacgtccagg tgacatccga gcccgcgatc      1140
     tatgtgctcg atcgcggcca gggcgtgccg cccgacgagc gcatggccat cttcgagcgt      1200
     tttcagcgca gccccaacac ggcgagttcc ggcaccggtc tcgggctcgc cattgtcgcc      1260
     gagatcgccg cccgccacca cgccgtggcc agcgtggagg cgcgtgcggg gggcggcagc      1320
     atatttgcga tccggtggat caactcggct tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page