(data stored in ACNUC1104 zone)

EMBL: CP002026.PE56

CP002026.PE56        Location/Qualifiers
FT   CDS_pept        complement(44858..46054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0056"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   xau:Xaut_3306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87393"
FT                   /db_xref="GOA:D6ZZX9"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZX9"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ADH87393.1"
FT                   /translation="MDQVLFVVGTHPVTLAQAIAGAAALGFLLLVLVLRAVSRNARQSA
FT                   LEADEQARRADELETRLVELARTQAETVGRVQSMAEVLAQRQGELARAVAERLDATTHR
FT                   MGESLARSAEATHENLAKLNERLALVDQARLSLGELSGQVMSLRETLANKQARGAFGEG
FT                   RLQALVSDGLPRDSFAFQHTLANGRRADCAIFLPGDKRPLLVDSKFPLEAVTAFREAQT
FT                   DDARKQAQTRLKGDVGKHVKDIAERYLVSGETQDIALMFVPSESVYAELHEHFDEVIQQ
FT                   AFRARVVIVSPSLLMLAVQVVQAICKDARMREQADLIRAECGKLVADVIRLRDRVGNLQ
FT                   KHFGQVNEDVAQALTSADKIAKRGARIEQLEFEGEAIPATEPELPDTLPMLGLRGAAE"
     atggatcagg tcctcttcgt cgtcggcacg catccggtga cgctggcgca ggcgattgcc        60
     ggcgcggcgg cgctcggctt cctcctgctc gtgctggttc tgcgcgcggt ctcgcgcaat       120
     gcaaggcaga gcgcgctgga ggccgacgag caggcccgcc gcgccgatga attggagacc       180
     cgcctcgtcg aactcgcccg cacccaggcc gagacggtcg gacgtgtgca gtccatggcc       240
     gaggtgctcg cgcaacgcca gggcgagctc gcccgcgccg tcgccgagcg gctcgacgcc       300
     accacccacc gcatgggcga gagcctcgcc cgctcagccg aggcgacgca cgagaacctc       360
     gccaagctca atgagcgcct cgccctcgtc gatcaggccc gtctcagcct cggcgagctc       420
     tccggccagg tgatgagcct gcgcgagacg ctggcgaaca agcaggcgcg cggcgccttc       480
     ggcgaggggc ggctgcaggc gctggtttcc gacggcctgc cgcgcgacag cttcgccttc       540
     cagcacacgc tggcgaatgg gcggcgcgcc gactgcgcca tcttcctgcc cggcgacaag       600
     cgcccgctgc tggtcgattc caagttcccg ctggaggccg tcaccgcctt ccgcgaggcg       660
     cagaccgacg acgcgcgcaa gcaggcgcag acccggctca agggcgatgt cggcaagcat       720
     gtgaaggaca tcgccgagcg ctacctcgtc agcggcgaga cgcaggacat cgcgctgatg       780
     ttcgtgccgt ccgagtcggt ctatgccgag ctgcacgagc atttcgacga ggtgatccag       840
     caggcgttcc gcgcccgcgt cgtcatcgtg tcgccctcgc tgctgatgct ggcggtgcag       900
     gtggtgcagg cgatctgcaa agatgcgcgc atgcgcgagc aggccgatct catccgcgcc       960
     gaatgcggca agctggtcgc ggacgtgatc cgcctgcgcg accgggtcgg caatctgcag      1020
     aagcatttcg gccaggtgaa cgaggacgtg gcgcaggcgc tgacctccgc cgacaagatc      1080
     gccaagcgcg gcgcccgcat cgagcagttg gagttcgagg gcgaggcgat cccggcgacc      1140
     gagccggagc tgccggacac gctccccatg ctcggtctca ggggtgcggc ggagtag         1197
//

If you have problems or comments...

PBIL Back to PBIL home page