(data stored in ACNUC1104 zone)

EMBL: CP002026.PE560

CP002026.PE560       Location/Qualifiers
FT   CDS_pept        complement(593110..595233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0564"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   mpo:Mpop_4323 diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87897"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D7A477"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH87897.1"
FT                   /translation="MSGPCPKSAGRTGARLGDRNFAGLLDIMRDGFAVFDDQDRLIFHN
FT                   RRFLELFPFLEALGDLQGLTFYALASVPSGEWRWAPDPEKYVAQRLQRHAEADGEPFLI
FT                   PLENGGWVQARERRTPDGWTVSTWSDVSGLKAAETRLDDAIDGIPAGLILLDAEDRIEL
FT                   VNSGMRRIFAGADVALEAGQRLPEVLDGAEAKGFFALGPGDGAIRERLARSAQQPVEIA
FT                   LRDGGWILASHRRLPNGGTVGIWTDLTTQKKREAELIAMREQLRQHTEALADFARLIAQ
FT                   QARNDMLTGLPNRFALEERLDQLLRDGETGNLWVGVIDVDHFKGINDAVGHAAADDLLR
FT                   EVGRFLRGHLRGDDMLARIGADEFAMVLTELDEGEVMGIANRLHAATHSHVFRIGGHRF
FT                   SLTVSVGLSLAQPDRHSAASLLAAADTACRVAKEAGRDRVQIYDLGDPKVSTTQQRLGW
FT                   AERIRLGLELNRFTLHLQAIVDEKHRILGYEALIRLRNEDGAYCSPAQFLPAARRLGLM
FT                   GRIDSWVCRQCVGYAMQLIATGSDQYVSMNLGVHTLANIAFQSRLLDLVRTNPGVEQAL
FT                   RIEITETDEIYDAPQVSAFLAEMRELGMHVSLDDFGNGYNSFEALKQLPVDGIKIDWTV
FT                   TRDLLHDPIDEAQIRAAVSIAHSLGLELVIEGVEEEAQLVRLKELGATLFQGFYFHRPI
FT                   DAADIFEALPLAR"
     atgtccggcc cctgccccaa atcggcaggg cggaccggag cgcgacttgg cgaccgcaac        60
     ttcgccgggc tgctcgacat catgcgcgac ggcttcgcgg tgttcgacga ccaggaccgc       120
     ctcatctttc acaaccgccg cttcctcgag ctctttccct ttctcgaggc cctcggcgac       180
     ctccagggcc tcaccttcta cgcgctcgcc tccgttccca gcggcgaatg gcgctgggcg       240
     cccgatcccg agaaatatgt cgcccaacgg cttcagcgcc atgccgaggc cgatggcgag       300
     cccttcctga tcccgctgga gaatggcggc tgggttcagg cacgcgagcg gcgcacgccg       360
     gacggctgga ccgtgtcgac ctggagcgac gtctccgggc tgaaggccgc cgagacccgg       420
     ctggacgacg ccatagacgg gattcccgcc ggcctcatcc tgctcgatgc cgaggaccgg       480
     atcgaactcg tcaacagcgg catgcggcgg atattcgccg gcgccgacgt cgccctggag       540
     gcgggtcaac gcctgccgga ggtgctcgac ggagcggagg cgaaaggctt cttcgccctc       600
     ggccccggcg acggcgcgat ccgcgagcgg ctcgcccgct cggcgcagca gccggtcgag       660
     atcgcgctac gcgacggcgg ctggatcctg gccagccatc gccgcctgcc caatggcggc       720
     acggtcggca tctggaccga cctcaccacg cagaagaagc gcgaggccga gctgatcgcc       780
     atgcgggagc agctgcgcca gcacaccgag gcgctggcgg acttcgcccg cctgatcgcc       840
     cagcaggcgc gcaacgacat gctgaccggt ctgcccaacc gcttcgcgtt ggaggagcgg       900
     ctcgaccagc tgctgcgcga cggcgagacg gggaatctct gggtcggcgt catcgacgtc       960
     gaccatttca agggcatcaa cgacgccgtc ggccatgccg ccgccgacga cctgctgcgc      1020
     gaggtcggcc gtttcctgcg cggccatctg cgcggcgacg acatgctggc gcggatcggc      1080
     gccgacgaat tcgccatggt gctcaccgag ctcgacgagg gcgaagtgat gggcatcgcc      1140
     aaccggcttc atgccgctac ccacagccat gtcttccgga tcggcggaca tcgcttctcg      1200
     ctgacggtca gcgtcgggct gagcctcgcc cagccggacc ggcacagcgc cgccagcctg      1260
     ctcgccgccg ccgacaccgc ctgccgggtg gcgaaggagg cgggacgcga ccgcgtgcag      1320
     atctacgacc tcggcgatcc caaggtgagc acgacgcagc aacggctcgg ctgggccgag      1380
     cgcatccggc tcggcctcga gctgaaccgc ttcacgctgc atctgcaggc gattgtcgac      1440
     gagaagcacc gcatcctcgg ctacgaggcg ctgatccgcc tgcgcaacga ggacggcgcc      1500
     tattgcagcc cggcccagtt cctgccggcg gcgcgccggc tcgggctgat gggccgcatc      1560
     gacagctggg tctgccgcca gtgcgtgggc tatgcgatgc agctcatcgc caccggcagc      1620
     gaccagtatg tgtcgatgaa tctcggcgtg cacacgctcg ccaacatcgc cttccagagc      1680
     cggctgctcg acctcgtgcg caccaatcca ggcgtcgagc aggcgctgcg catcgagatc      1740
     accgagaccg acgagatcta cgacgccccg caggtctccg ccttccttgc tgagatgcgc      1800
     gagctcggca tgcatgtctc gctcgacgat ttcggcaatg gctacaattc cttcgaggcg      1860
     ctgaagcaac tccccgtcga cggcatcaag atcgactgga ccgtcacccg cgacctgcta      1920
     cacgacccga tcgacgaggc gcagatccgc gcggccgttt ccatcgccca ttctctgggg      1980
     ctggaactgg tgatcgaggg cgtcgaagag gaggcccagc tcgtccggct gaaggagctc      2040
     ggcgcgacgc tgttccaggg cttctatttc caccgcccca tcgacgcggc ggatattttc      2100
     gaggcgctcc ccctcgcgcg ttag                                             2124
//

If you have problems or comments...

PBIL Back to PBIL home page