(data stored in ACNUC1104 zone)

EMBL: CP002026.PE568

CP002026.PE568       Location/Qualifiers
FT   CDS_pept        complement(603342..603833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc00031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87905"
FT                   /db_xref="GOA:D7A485"
FT                   /db_xref="UniProtKB/TrEMBL:D7A485"
FT                   /inference="similar to AA sequence:KEGG:SMc00031"
FT                   /protein_id="ADH87905.1"
FT                   /translation="MELSSLVAPLVTALGSWPGARWLQGSGTAYLFVNATHVLGISLLL
FT                   GSILVLDLKLLGGLRGVPLAVLGPLNVRVAACGVALAFATGFWLFTVQPREYVGNPAFL
FT                   IKLGLIALALANVGVQHANPAYGRALEGATVSAGVRVSAAASALLWLAVLVSGRWIGFV
FT                   "
     atggagctgt cgagcctcgt cgccccgctt gtcactgctt tgggaagctg gcccggcgcc        60
     cgctggctgc agggctcggg cacggcgtac ctcttcgtca acgcgacgca tgtgctcggc       120
     atctcgctgc tgctcggctc gatactcgtg ctggatttga agctgctcgg cgggctgcgc       180
     ggcgtgccgc tcgccgttct cggcccgctc aatgtgcgcg tcgccgcgtg cggcgtggca       240
     ctggcatttg ctacgggctt ctggctgttc accgtccagc cgcgcgaata tgtcggcaac       300
     cccgccttcc tgatcaagct cggcctgatc gccctcgcct tggccaatgt cggcgtgcag       360
     cacgccaacc cggcctatgg gcgcgcgctc gaaggcgcca cggtcagcgc cggggtgcgg       420
     gtatcggcgg cggcctcggc gctgctctgg ctcgctgttc tggtgtccgg ccgctggatc       480
     ggcttcgtgt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page