(data stored in ACNUC1104 zone)

EMBL: CP002026.PE569

CP002026.PE569       Location/Qualifiers
FT   CDS_pept        complement(603840..604235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hne:HNE_3363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A486"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87906.1"
FT                   /translation="MSTAIRLPSLRVSALTLAGALAFVTPALAHHGWSWAESEQMTLQG
FT                   TIKTISMSPPHPTLHVTASDGVVWQVDLGNPRQTADSGFTGDTAKPGDAITVLGNRDRD
FT                   SAKPHMKAVRLTLAGKNYDMYPERITN"
     atgtcgaccg cgatccgcct tccctccctt cgcgtttccg ccctcacgct tgccggcgcg        60
     ctcgccttcg tcacgccggc acttgctcat cacggctgga gctgggccga gtccgagcag       120
     atgacgctgc agggcaccat caagaccatc tccatgtcgc cgccgcaccc gacgctgcac       180
     gtcaccgcga gcgacggcgt ggtgtggcag gtcgatctcg gcaatccgcg ccagaccgcc       240
     gattccggct tcaccggcga cacagcgaaa ccgggtgatg ccatcaccgt gctgggcaac       300
     cgcgaccgcg attccgcaaa accgcacatg aaggcggtgc gcctcaccct ggccggcaag       360
     aattacgaca tgtacccgga gcggatcacc aactaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page