(data stored in ACNUC1104 zone)

EMBL: CP002026.PE57

CP002026.PE57        Location/Qualifiers
FT   CDS_pept        46166..46714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0057"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; KEGG: xau:Xaut_3305
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87394"
FT                   /db_xref="GOA:D6ZZY0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY0"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ADH87394.1"
FT                   /translation="MSIRPLVIIPDSRLRLISDPIVRVDARVRAIVEDMFETMYDAPGI
FT                   GLAAVQVGIPERIITVDVVRREEGEEEGAEEKKNPIALINPEIISSSEEISVYSEGCLS
FT                   IPEYYADVERPARVKVRYMDLNGETQEIDADGLLATCVQHEIDHLNGVLFIDHISKLKR
FT                   DRVMKKFTKIAKEKERDGV"
     atgtcgatac gtcccctggt catcatcccc gattcccggc tgcggctgat ttccgacccc        60
     atcgtgcggg tcgatgcgcg ggtgcgcgcc atcgtcgagg acatgttcga gaccatgtac       120
     gacgctcccg gcatcgggct ggcggcggtc caggtcggca tccccgagcg catcatcacc       180
     gtcgacgtcg tccggcgcga ggaaggcgag gaagaaggcg cggaggagaa gaagaatccg       240
     atcgcgctga tcaacccgga gatcatctcc tcttccgagg agatctcggt ctattcggaa       300
     ggctgcctgt cgatcccgga atattacgcc gatgtcgagc ggccggcgcg ggtgaaggtc       360
     cgctacatgg acctcaacgg cgagacgcag gagatcgacg ccgacggcct tctcgcaacc       420
     tgcgtgcagc acgagatcga ccacctgaac ggcgtgctgt tcatcgacca catctccaag       480
     ctcaagcgcg accgggtgat gaagaagttc accaagatcg ccaaggagaa ggagcgcgac       540
     ggggtctga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page