(data stored in ACNUC1104 zone)

EMBL: CP002026.PE570

CP002026.PE570       Location/Qualifiers
FT   CDS_pept        complement(604673..607111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0574"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: azc:AZC_1009 DNA gyrase B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87907"
FT                   /db_xref="GOA:D7A487"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A487"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADH87907.1"
FT                   /translation="MADSDNAATPSSNGEDYGAQSIQVLRGLDAVRKRPGMYIGDTDDG
FT                   SGLHHMVYEVVDNAIDEALAGYADEVTVTLNADGSVTVTDNGRGIPTDIHAEEGVSAAE
FT                   VIMTQLHAGGKFNQNSYKVSGGLHGVGVSVVNALSTTLDLTIWRNGLEHHIRFRHGDAE
FT                   APLAVKGPAPEGRRGTMVTFVPSPDTFTHIEFDYATLEHRLRELAFLNSGVRIVLTDAR
FT                   HPEVKREEMMYEGGVEAFVQYLDRSKQALLPKPIVIRAEKDGIAVECAMSWNDSYHENV
FT                   LCFTNNIPQRDRGTHFTGFAAALTRQVIGYSERSGIAKKEKVEPTGEDCREGLTAVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPVVEALVNEALGSWLEEHPAESKSLVTKVVEAAAAREA
FT                   ARKARELTRRKNPLDVASLPGKLADCQERDPAKSELFIVEGDSAGGSAKMGRNRAFQAI
FT                   LPLRGKILNVERARFDKMLSSEQIGTLITALGTGIGRDDFNVDKLRYHKIIIMTDADVD
FT                   GSHIRTLLLTFFFRQMPDLLDRGHVYIAQPPLYKVTRGKSEQYLKDERSLEDYLIDQGL
FT                   DEAALHLASGEVRVGADLHHVLESTRSFRNVMNGLHPRYNRAVVEQAAIAGAFAPGLLI
FT                   EEERAAAVAAEVARRLDLIAEDTERGWTGEADGSGYRFSRTVRGVKEVAVLDATFVGSA
FT                   EARRLDSLSAELQEVHAEPATLRRKGNDTLVFGPMDLFDAVTDAGRKGIALQRYKGLGE
FT                   MNAEQLWETTLDVNARSLLQVKVKEVADADDLFNRLMGDVVEPRREFIQDNALRASVDV
FT                   "
     atggccgatt ccgacaacgc cgcgaccccg tcttccaacg gcgaggacta cggcgcgcag        60
     tcgatccagg tgctgcgcgg gctggacgcc gtgcgcaagc gcccgggcat gtatatcggc       120
     gacaccgatg acggctcagg cctgcaccac atggtctacg aggtggtgga caacgccatc       180
     gacgaggcgc tggccggcta tgccgacgag gtgacggtga cgctcaacgc cgacggctcg       240
     gtcaccgtga ccgacaatgg ccgcggcatc ccgaccgaca tccatgccga ggaaggcgtc       300
     tcggcggccg aggtcatcat gacccagctc catgccggcg gtaaattcaa ccagaattcc       360
     tacaaggtct ccggcggcct gcacggcgtc ggcgtctcgg tggtgaacgc actgtccacc       420
     acgctcgacc tgaccatctg gcgcaacggg ctggagcatc acatccgctt ccgccacggc       480
     gacgccgagg caccgctggc ggtgaagggc ccggcgcccg agggccggcg cggcaccatg       540
     gtcaccttcg tgccgagccc ggacaccttc acccatatcg aattcgacta cgccacgctg       600
     gaacatcgcc tgcgcgaact cgccttcctc aattccggcg tgcgcatcgt gctgaccgat       660
     gcgcgccacc cggaggtgaa gcgcgaggag atgatgtatg agggcggcgt cgaagccttc       720
     gtgcagtatc tcgaccgctc caagcaggct ttgctgccca agcccatcgt catccgcgcg       780
     gagaaggacg gcatcgccgt cgaatgcgcg atgtcgtgga acgacagcta ccacgagaac       840
     gtgctctgct tcaccaacaa catcccgcag cgcgaccgcg gcacgcattt caccggcttc       900
     gccgccgcgc tgacgcgcca ggtcatcggc tattccgagc gctcgggcat cgccaagaag       960
     gagaaggtcg agccgaccgg cgaggattgc cgcgagggcc tgaccgccgt cctgtcggtg      1020
     aaggtgccgg acccgaaatt ctcctcgcag accaaggaca agctggtctc ctccgaggtg      1080
     cgccctgtcg tcgaggcgct ggtgaacgag gcactcggca gctggcttga ggagcatccg      1140
     gccgagagca agagcctcgt caccaaggtg gtcgaggccg ccgccgcgcg cgaggccgcc      1200
     cgcaaggcgc gcgagctcac ccgccgcaag aacccgctcg acgtcgcctc cctgcccggc      1260
     aagctcgccg actgccagga gcgcgacccg gccaagtccg agctcttcat cgtcgagggc      1320
     gactcggccg gcggctcggc caagatgggc cgcaaccgcg ccttccaggc catcctgccg      1380
     ctgcgcggca agatcctgaa cgtggagcgc gcccgcttcg acaagatgct gtcctccgag      1440
     cagatcggta cgctgatcac cgcgctcggc accggcatcg gccgcgacga cttcaacgtc      1500
     gacaagctgc gctaccacaa gatcatcatc atgacagacg cggacgtgga cggctcccac      1560
     atccgcacgc ttctgcttac cttcttcttc cggcagatgc cggatctact cgatcgcggc      1620
     catgtctaca tcgcccagcc gccgctctat aaggtcacgc gcggcaagtc cgagcagtat      1680
     ctgaaggacg agcgctcgct cgaggactac ctgatcgacc agggtctcga cgaggccgcg      1740
     ctgcatctcg cctccggcga ggtgcgggtc ggcgccgacc tgcaccacgt gctggagagc      1800
     acccgctcct tccgcaacgt gatgaacggg ctgcaccccc gctacaaccg cgccgtggtc      1860
     gagcaggcgg cgatcgccgg cgccttcgcg ccggggctgc tcatcgagga ggaacgcgcc      1920
     gctgcggtcg ccgccgaggt ggcgcggcgc ctcgacctca tcgccgagga caccgagcgc      1980
     ggctggaccg gcgaggccga cggctccggt tacagattct cccgcaccgt gcgcggcgtg      2040
     aaggaagtcg ccgtgctcga cgccaccttc gtcggctcgg ccgaggcgcg ccgtctcgac      2100
     agcctctccg ccgagctgca ggaagtccac gccgagccgg cgacgctgcg ccgcaagggc      2160
     aacgacacgc tggtcttcgg gccgatggac ctgttcgacg ccgtcaccga cgccggtcgc      2220
     aagggcatcg cgctgcagcg ctacaagggc ctcggcgaga tgaacgccga gcagctctgg      2280
     gagaccacgc tcgacgtcaa cgcccgctcg ctgctgcagg tgaaagtaaa ggaggtcgcc      2340
     gacgccgacg acctgttcaa ccgcctgatg ggcgacgtcg tcgagccccg ccgcgagttc      2400
     atccaggaca acgcactgcg cgccagcgtg gacgtgtaa                             2439
//

If you have problems or comments...

PBIL Back to PBIL home page