(data stored in ACNUC1104 zone)

EMBL: CP002026.PE571

CP002026.PE571       Location/Qualifiers
FT   CDS_pept        complement(607169..607783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0575"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   azc:AZC_1010 LysE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87908"
FT                   /db_xref="GOA:D7A488"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D7A488"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADH87908.1"
FT                   /translation="MGILDLVVFAAALALAAASPGPSVIALVARTLVRGREGAALLVAG
FT                   IVLGDMVWLAGAALGLAALAVTLGSLFFLVRLAAAAYLIYLAYKLWTAPAQPAEAAEIR
FT                   EADSRAGLFLTGLGMTLGNPKAMAFYLALLPSIVDLNHLTMLGFAELCGVISVVLTLVF
FT                   GSYVALAHRARHLAASPRGIRLINRTCGTAMAGAAVLVATK"
     atgggcattc tcgacctcgt cgtcttcgcc gccgccttgg cgctggccgc cgcctcgccg        60
     ggaccgagcg tgatcgcgct cgtcgcccgc acgctggtgc gcgggcgcga gggcgccgcg       120
     ctgctggtcg ccggcatcgt gctcggcgac atggtgtggc tcgctggcgc ggcgctgggc       180
     cttgccgcgc tcgccgtcac gctgggctcc ctgttcttcc ttgtgcggct ggctgcggct       240
     gcctatctga tctatctcgc ctacaagctg tggacggcgc cggcgcagcc cgcggaagcg       300
     gcggagatcc gtgaggcgga ttcccgcgcg ggcctgttcc tcaccgggct ggggatgacg       360
     ctgggcaacc cgaaggccat ggccttctac ctcgctctgc tgccgagtat cgtcgacctc       420
     aaccatttga cgatgcttgg ctttgccgag ctctgcggcg tcatctcggt ggtgctgacc       480
     ctcgtgttcg gcagctatgt ggccctcgcc caccgggcgc ggcacctcgc cgccagcccg       540
     cgcggcataa ggctgatcaa ccggacctgc ggcacggcga tggccggcgc cgccgttctg       600
     gtggccacga aataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page