(data stored in ACNUC1104 zone)

EMBL: CP002026.PE573

CP002026.PE573       Location/Qualifiers
FT   CDS_pept        complement(608997..610112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0577"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: azc:AZC_1013 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87910"
FT                   /db_xref="GOA:D7A490"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D7A490"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADH87910.1"
FT                   /translation="MKVTVERAELLKSLAHVHRVVERRNTIPILANVLMRTDARGLALR
FT                   ATDLDIEIVETIAAEVGQEGATTVPAHTIYDIVRKLPEGAQVQIETSGDRGTLTVRAGR
FT                   SRFALQTLPETEFPDLAAGEMTHRFTLPAGELKRLVDKTQFAISTEETRYYLNGIYLHV
FT                   ADASGPVLRAVATDGHRLAQAQTTAPAGATGMPGVIVPRKAVAEIQRLAEDAEAEVTVE
FT                   LSTAKIRVSLDRVVLTSKLIDGTFPDYGRVIPLGNDKTLVVDKADFASAVDRVSTVASE
FT                   RGRAVKLSIGDGKLTLSVTNPDSGSATEEIEVEYAAEPIDIGFNSRYLLDITSQIEGGT
FT                   AELKLADPGSPTLVQDPEKRGALYVLMPMRV"
     atgaaggtca ccgtcgagcg ggccgagttg ctcaagtctc tggcccacgt ccatcgtgtc        60
     gtcgagcggc gcaacaccat cccgatcctc gccaatgtgc tgatgcgcac ggatgcgcgc       120
     gggctcgcct tgcgcgccac cgacctcgac atcgagatcg tcgagaccat cgccgcggaa       180
     gtaggccagg aaggcgccac taccgtgccg gcgcacacca tctacgacat cgtgcgcaag       240
     ctgcccgagg gcgcgcaggt gcagatcgag acctccggcg accgcggcac gctgaccgtg       300
     cgcgccgggc gctcgcgctt cgcgctgcag acgctaccgg agaccgagtt cccggatctc       360
     gccgccggcg agatgacgca ccgcttcacc ctgcccgcgg gcgaactgaa gcgcctcgtc       420
     gacaagaccc agttcgccat ctcgaccgaa gagacccgct attatctcaa cggcatctac       480
     ctgcacgtcg ccgatgccag cggcccggtg ctgcgcgcgg tggcgaccga cggccaccgc       540
     ctcgcccagg cgcagaccac cgcgccggcg ggcgcgacgg gcatgccggg cgtcatcgtg       600
     ccgcgcaagg cggtcgccga gatccagcgc ctcgccgagg atgccgaggc cgaggtgacg       660
     gtggagctct ccaccgccaa gatccgcgtc tcgctcgacc gcgtggtgct gacctccaag       720
     ctgatcgacg gcaccttccc ggactatggc cgcgtcatcc cgctcggtaa cgacaagacc       780
     ctcgtcgtcg acaaggccga cttcgcctcg gcggtcgacc gcgtgtcgac ggtggctagc       840
     gagcgcgggc gggcggtgaa gctctcgatc ggcgacggca agctgaccct ctcggtcacc       900
     aatccggatt cgggcagcgc gaccgaggaa atcgaggtcg aatacgcggc cgagccgatc       960
     gatatcggct tcaacagccg ctatctgctc gacatcacct cgcagatcga aggcggcacg      1020
     gccgagctca agctcgccga tccggggtcg cccacgctgg tgcaggaccc ggagaagcgc      1080
     ggcgcgctct atgtgctgat gccgatgcgc gtgtga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page