(data stored in ACNUC1104 zone)

EMBL: CP002026.PE58

CP002026.PE58        Location/Qualifiers
FT   CDS_pept        46760..47677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0058"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; KEGG:
FT                   xau:Xaut_3304 methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87395"
FT                   /db_xref="GOA:D6ZZY1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY1"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ADH87395.1"
FT                   /translation="MRIVFMGTPDFAVSTLAEIVGSGHEVVAAYTRAPAASGRRGLELV
FT                   PSPVHRAAEKLGVPVLTPSTLRTEEAAETFAAHEADVAVVVAYGRILPQMILDAPKLGC
FT                   LNLHASLLPRWRGAAPIQRAIMAGDAESGVAVMKMEAGLDTGPVGLVERVAIGADMTAG
FT                   ELHDRLMIVGADLMGRALAALERGALNFTPQPEAGVTYAAKIDKGETRIDWSKPAKQVH
FT                   DHIRGLSPFPGAWFEFDGVRVKVLRSTLVAGAGRPGEVIDDQLTIACADGAVRLTEVQK
FT                   AGSKAMGAADFLRGNELTRGTVLA"
     atgcgcatcg tcttcatggg cacgcccgac ttcgcggtct cgacgctcgc cgaaatcgtc        60
     ggcagcgggc acgaggtagt ggcggcctat acgcgcgcgc cggcggcttc cgggcggcgc       120
     gggctggagc tggtgccctc gccggtgcac cgcgcggcgg agaagctggg cgtgcccgtg       180
     ctcaccccct cgacattgcg taccgaagag gcggccgaga ccttcgccgc ccatgaggcg       240
     gatgtcgcgg tggtggtcgc ctatggccgc atcctgcccc agatgatcct cgacgcgccg       300
     aagctcggct gtctcaatct ccacgcctcg ctgctgccgc gctggcgcgg cgcggcgccg       360
     atccagcgcg ccatcatggc cggggatgcc gagagcggcg tcgcggtgat gaagatggag       420
     gccgggctgg ataccggccc ggtcggcctc gtcgagcgcg tcgccatcgg cgcggacatg       480
     acggcgggcg aactgcacga ccggctgatg atcgtcggcg ccgatctgat gggccgtgcg       540
     ctggcggcgc tggagcgcgg ggcgctgaat ttcacgccgc agccggaagc gggcgtcacc       600
     tacgctgcca agatcgacaa gggtgagacc cgcatcgact ggtcgaagcc ggcgaagcag       660
     gtgcatgacc atattcgcgg gctgtcgccc tttcccggcg cctggttcga gttcgacggc       720
     gtgcgggtga aggtgctgcg ctcgacgctt gttgccggcg cgggtcggcc gggcgaagtg       780
     atcgacgacc agctcaccat cgcctgtgcg gacggcgcgg tgaggctcac tgaggtgcag       840
     aaggccggca gcaaggcgat gggcgcggcc gacttcctgc gcggcaatga actcaccagg       900
     ggaacggtgc tggcatga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page