(data stored in ACNUC1104 zone)

EMBL: CP002026.PE59

CP002026.PE59        Location/Qualifiers
FT   CDS_pept        47674..48123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0059"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bbr:BB0221 acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87396"
FT                   /db_xref="GOA:D6ZZY2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY2"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH87396.1"
FT                   /translation="MTTIRRVEEADHAVWLPLWQGYLTFYEAELPAAVTRTTWQRLLDP
FT                   AEPVHGALAFDEDGRAVGLAHWLFHRSTWSEGNSCYLNDLFVDPGLRGKGVGRALIDHV
FT                   HADAAAKGSPKVYWLTHETNTTAQRLYNAVAERTGFMQYRKMTGC"
     atgacgacga taaggcgtgt cgaggaagcc gatcatgcgg tctggctgcc gctctggcag        60
     ggctatctca ccttctacga ggccgagctg ccggcggcgg tgacgcgcac cacctggcag       120
     cgcctcctcg atcccgccga gccggtgcat ggcgcgctcg ccttcgacga ggacggccgc       180
     gccgtgggcc tcgcccactg gctgttccac cgctcgacct ggagcgaggg caattcctgc       240
     tatctcaacg acctgttcgt cgatcccggc ctgcgcggca agggcgtcgg ccgcgcgctg       300
     atcgaccatg tccatgccga tgccgcggcc aaggggtcgc cgaaggtcta ttggctgacg       360
     cacgagacca acacgacggc gcagcgcctc tacaacgccg tggccgagcg cacggggttc       420
     atgcagtacc ggaagatgac gggctgctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page