(data stored in ACNUC1104 zone)

EMBL: CP002026.PE60

CP002026.PE60        Location/Qualifiers
FT   CDS_pept        complement(48256..48891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0060"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="KEGG: xau:Xaut_2363 peroxidase; PFAM: alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87397"
FT                   /db_xref="GOA:D6ZZY3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY3"
FT                   /inference="protein motif:PRIAM:1.11.1.7"
FT                   /protein_id="ADH87397.1"
FT                   /translation="MTIRLGDVVPDFEAETTEGPIRFHEWLGNSWGVLFSHPKNFTPVC
FT                   TTELGQVARLKPEFDRRNVKVIGLSVDPLDAHAKWSEDIAETQGYAPNFPLIADQDRKV
FT                   SDLYDMIHPNASDTMTVRSVFIVGPDKKLKLSLTYPASAGRNFDEILRVIDSLQLTATH
FT                   AVATPANWKNGDDVIIVPSVSDEAAKEKFPEGWKTLKPYLRVVPQPGK"
     atgaccatcc gccttggaga cgtcgttccc gatttcgaag ccgagaccac cgaaggtccg        60
     atccgcttcc atgagtggct tggtaattcc tggggcgtgc tgttctcgca tccgaagaac       120
     ttcacccccg tctgcaccac cgagctcggc caggtggcgc gcctcaagcc cgagttcgac       180
     cgccgcaacg tcaaggtgat cggcctctcc gtcgacccgc tcgacgccca tgccaaatgg       240
     tcggaggaca tcgccgagac gcagggctac gcgccgaact tcccgctcat cgccgatcag       300
     gaccgcaagg tctccgacct ctacgacatg atccacccga acgcctccga cacgatgacg       360
     gtgcgctcgg tgttcatcgt cgggccggac aagaagctga agctctccct cacctatccg       420
     gcgagcgcgg gccgcaactt cgacgagatc ctgcgggtga tcgactcgct gcagctcacc       480
     gccacccacg ccgtcgccac gccggcgaac tggaagaacg gcgacgacgt catcatcgtc       540
     ccctccgtga gcgacgaggc ggcgaaggag aagtttcccg aggggtggaa gacgctgaag       600
     ccgtatctgc gcgtcgtgcc gcagccggga aagtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page