(data stored in ACNUC1104 zone)

EMBL: CP002026.PE62

CP002026.PE62        Location/Qualifiers
FT   CDS_pept        complement(49475..50095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0062"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: Peptidase S24/S26A/S26B, conserved region;
FT                   KEGG: nwi:Nwi_0466 peptidase S24"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87399"
FT                   /db_xref="GOA:D6ZZY5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY5"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ADH87399.1"
FT                   /translation="MLTHAQIWRAIDQLAERHGLSASALAKRAGLDPTTFNRSKREQPD
FT                   GRARWPSTESIAKILAATGASLDDFMALIGGGTRRAIPLIGFAQAGRGGYFDDAGFPVG
FT                   GAWDEIEFPNVGDEHAYALEIAGDSMLPLYRDGDVVVVSPAAATRRGDRVIVKTREGEV
FT                   MAKELKRRTAKTVELRSLNPEHADRVFQEGEIAWIARVLWASQ"
     atgctgaccc acgcccagat ctggcgggcc atcgaccagt tggcggagcg ccacgggctg        60
     agcgcctccg cgctcgccaa gcgggcgggg ctggacccca ccaccttcaa ccgctccaag       120
     cgcgagcagc cggacgggcg cgcgcgctgg ccctccaccg agagcatcgc caagatcctc       180
     gccgcgaccg gcgccagcct cgacgacttc atggcgctga tcggcggcgg cacgcggcgg       240
     gccatcccgc tcatcggttt cgcccaagcc ggccgcggcg gctatttcga cgatgccggc       300
     ttcccggtcg gtggcgcctg ggacgagatc gagtttccca atgtcggcga cgagcatgcc       360
     tatgcgctgg agatcgccgg cgattccatg ctgccgctct accgcgacgg cgacgtcgtc       420
     gtggtctcgc cggcggcggc cacaaggcgc ggcgaccggg tgatcgtgaa gacccgcgag       480
     ggcgaggtga tggccaagga gctcaagcgc cgcaccgcca agacggtcga attgcgctcg       540
     ctcaaccccg agcacgccga ccgggtgttc caggaaggcg agatcgcctg gatcgcccgc       600
     gtgctgtggg cgagccaata g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page