(data stored in ACNUC1104 zone)

EMBL: CP002026.PE65

CP002026.PE65        Location/Qualifiers
FT   CDS_pept        52058..53149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0065"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase; KEGG:
FT                   rpb:RPB_4622 dihydroorotate dehydrogenase 2; PFAM:
FT                   dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87402"
FT                   /db_xref="GOA:D6ZZY8"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY8"
FT                   /inference="protein motif:TFAM:TIGR01036"
FT                   /protein_id="ADH87402.1"
FT                   /translation="MSALFDLALPFARLMDPENAHRLAIRALACLPPRAPEPDDARLKV
FT                   EAFGLRFPNPVGLAAGFDKEAEVPDAMLGAGFGFVEVGTITPRPQSGNPRPRNFRLTED
FT                   RAVINRYGFNSGGHGPAKARLIARKGKSRNSAGIVGVNVGANKETVDRAADYVAGIEAF
FT                   AGLGDYFTVNVSSPNTPGLRDLQEETALDDLLARCVEARDRHAPGVPLLLKIAPDLALP
FT                   HLDGVVEVAHRRRVDGLIVSNTTISRPPGLRSPHKGETGGLSGRPLFALSTRMLAETYV
FT                   RADGAFPIIGVGGIDSAETAFAKIEAGASLIQLYSGLVYEGLGLVPRIKAGLLARLAKE
FT                   HATLAEITGRRARQVVAEPFPGA"
     atgagtgcgc tgttcgacct cgctctgccc ttcgcccggc tgatggaccc ggagaacgcg        60
     caccgcctcg ccatacgcgc gctcgcctgc ctgccgccgc gcgcgcccga gcccgacgat       120
     gcgcggctga aggtcgaggc cttcggcctg cgcttcccca acccggtggg actggcggcg       180
     ggcttcgaca aggaggcgga ggtgccggac gccatgctcg gcgccggctt cggcttcgtc       240
     gaggtcggca cgatcacgcc gcgcccgcag tcgggcaatc cgcgcccgcg caatttccgc       300
     ctcaccgagg accgcgcggt gatcaaccgc tacggcttca attccggcgg ccatggcccc       360
     gcgaaagcgc ggctcatcgc ccgcaagggc aagagccgca actctgcggg catcgtcggg       420
     gtgaatgtcg gggcgaacaa ggagacggtg gaccgcgccg ccgactacgt cgccggcatc       480
     gaggccttcg ccgggctcgg cgactatttc accgtcaacg tctcctcgcc caacacgccg       540
     ggcctgcgcg acctgcagga ggagaccgcg ctcgacgacc tgctcgcgcg ctgcgtggag       600
     gcgcgcgacc gccatgcgcc gggcgtgccg ctgctcctga agatcgcgcc cgatctcgcg       660
     ctgccccatc tcgacggcgt ggtcgaggtg gcgcaccgac gccgggtcga cgggctgatc       720
     gtttccaaca ccaccatctc gcgcccgccc ggcctgcgtt ctccgcacaa gggcgagacc       780
     ggcgggctct ccggccggcc gctctttgcg ctctccaccc gcatgctggc ggagacctat       840
     gtgcgcgcgg acggcgcctt cccgatcatc ggcgtcggcg gcatcgacag cgccgagacg       900
     gcgttcgcca agatcgaggc cggcgccagc ctgatccagc tctattccgg cctggtctat       960
     gaggggctgg gtctggtgcc gcgcatcaag gctggcctcc tcgcccggct ggcgaaggag      1020
     cacgcgacac tcgccgagat caccggccgg cgggcgcggc aggtggtggc ggagccgttt      1080
     ccgggcgcct ag                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page