(data stored in ACNUC1104 zone)

EMBL: CP002026.PE66

CP002026.PE66        Location/Qualifiers
FT   CDS_pept        complement(53146..54471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0066"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: rpe:RPE_0723 MATE efflux family protein;
FT                   TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87403"
FT                   /db_xref="GOA:D6ZZY9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZY9"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADH87403.1"
FT                   /translation="MELALPGRVEVTSRRFLAIALPATLAQMTTPLLGLVATGAIGRLG
FT                   DAVLLGAVAVGALLFDFVFWIFGSLRMGTAGLTAQALGRGETVELRAVLIRALLISAAI
FT                   GIALILVHLPLAHVAFLAMGASAGVHEAAALYFSVRILSAPFAIGNFAVLGWLVGIART
FT                   DIGLGLQILIAGVNAAATALLVLYWDFGIAGAAAANVLAEFVGMLFGFGAALRLLGRDW
FT                   HVPWRTVLDRARLIETVAVNSDIMIRTGLLMLVLVFFTAQGARQDDVTLAANAVLYNMV
FT                   MVSAFFLDGFATAAEQICGQSIGAQDRPGFRRAVRMVLFWGFGFAAPASLLLLFGGGGL
FT                   IDLLSANPEVRLVGREFLPLAAATPLLGVAAFAYDGIYSGSTWARDMRNLMVPAVLLFF
FT                   LAWWLTLPLGNTGLWLAYLSFMAGRGIFLALRLPALERRTFA"
     gtggagctcg cgcttcccgg tcgggtggag gtcacttccc ggcgcttcct cgccatcgcc        60
     ctgccggcga cgctggcgca gatgacgacg ccgctgctcg ggctggtggc gacgggcgcc       120
     atcggccggc tcggcgacgc ggtgctgctc ggcgcggtgg cggtcggcgc gctgctgttc       180
     gacttcgtgt tctggatctt cggctcgctg cgcatgggca cggcggggct gaccgcgcag       240
     gcgctcgggc gcggcgagac ggtggagctg cgcgccgtgc tcatccgcgc gctgctgatc       300
     tccgccgcca tcggcatcgc cctgatcctc gtgcacctgc cgctcgccca tgtcgccttc       360
     ctcgccatgg gcgccagcgc gggcgtgcac gaggcggcgg cgctgtattt ctccgtgcgc       420
     atcctctcgg cgccctttgc catcggcaat ttcgccgtgc tcggctggct ggtcggcatc       480
     gcccgcaccg atatcggcct cggcctgcag atcctcatcg ccggcgtgaa cgccgccgcc       540
     acggcgctcc tcgtcctcta ctgggatttc ggcatcgccg gcgccgccgc cgccaatgtg       600
     ctggccgaat tcgtcggcat gctgttcggc ttcggggcgg ccctccgcct gctcgggcgc       660
     gactggcatg tgccgtggcg caccgtgctc gaccgggcgc ggctgatcga gacggtcgcg       720
     gtaaacagcg acatcatgat ccgcaccggc ctgctcatgc tggtgctggt gttcttcacc       780
     gcgcagggcg cacggcagga cgacgtgacg ctcgccgcca atgccgtgct ctacaacatg       840
     gtcatggtga gcgcgttctt cctcgacggc ttcgccaccg ccgccgagca gatctgcggc       900
     cagagcatcg gcgcgcagga ccggccgggc ttccgccgcg ccgtccgcat ggtgctgttc       960
     tggggcttcg gcttcgctgc gccggcgagc cttctcctgc tgttcggcgg cggcgggctc      1020
     atcgacctgc tctccgccaa tccggaggtg cgcctcgtcg gccgcgaatt cctgccactg      1080
     gccgccgcga cgcccctgct cggcgtcgcc gccttcgcct atgacggcat ctattccggc      1140
     tcgacctggg cacgcgacat gcgcaacctg atggtgccgg cggtcctgct gttcttcctt      1200
     gcctggtggc tgaccctgcc gctgggaaat accggactgt ggctcgctta cctctccttc      1260
     atggccgggc gtggcatatt cctcgccctg cgcctgcccg cgctggagcg gcggactttc      1320
     gcctag                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page