(data stored in ACNUC1104 zone)

EMBL: CP002026.PE69

CP002026.PE69        Location/Qualifiers
FT   CDS_pept        complement(56454..57512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0069"
FT                   /product="putative mRNA 3-end processing factor"
FT                   /note="KEGG: xau:Xaut_1471 putative mRNA 3-end processing
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87406"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ2"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1471"
FT                   /protein_id="ADH87406.1"
FT                   /translation="MRPEELLHSTPQGLYSPAGDFFIDPTRPVPRALITHGHSDHARAG
FT                   HGAVMATRQTLDIMAIRYGEGFAGTTQAAEYGERVEVNGVGVTFHPAGHILGSAQIALD
FT                   HKGCTIVASGDYKPGADPTAAPFEPIRCTIFISEATFGLPVFRHPDPAEETAKLTASLA
FT                   LFPERAHLVGAYALGKAQRVMALLRAAGHEKPILIHGAMERLTDYYQSQGIDLGDIRLA
FT                   REVKPAELAGSVVICPPSAMTDLWSRRFPDPVTAFASGWMRIRARARQNGVELPLIISD
FT                   HADWDDLQDAILATGCEELWVTHGQEDALVHWALLAGLRARPLHMVGYGEEEAETTAAP
FT                   DTSATESPEAQP"
     atgcgcccgg aagagcttct ccactccaca ccgcagggcc tgtattcccc ggccggcgat        60
     ttcttcatcg acccgacgcg gcccgtgccg cgcgcgctca tcacgcacgg ccattccgac       120
     catgcccgcg ccggccatgg cgcggtgatg gcgacgcgcc agacgctcga catcatggcg       180
     atccgctatg gcgagggctt cgccggcacg acgcaggccg cggaatatgg cgagcgtgtc       240
     gaggtgaacg gcgtcggcgt caccttccat cccgccgggc acatcctcgg ctcggcgcag       300
     atcgcgctcg accacaaggg ctgcaccatc gtcgcctcgg gcgactacaa gcccggcgcc       360
     gacccgaccg cggcgccatt cgagccgatc cgctgcacca tcttcatctc ggaagcgacc       420
     ttcggcctgc cggtgttccg ccatcccgat cctgcggagg agacggccaa gctcaccgcc       480
     tcgctcgcgc tgttccccga gcgggcgcat ctcgtcggcg cctatgcgct cggcaaggcg       540
     cagcgggtga tggcgctgct ccgtgccgcc gggcatgaga agcctatcct catccatggc       600
     gccatggagc ggctgaccga ctattaccag tcgcagggca tcgacctcgg cgacatccgc       660
     ctcgcccgcg aggtgaagcc cgccgaactc gccggctcgg tggtcatctg cccgcccagc       720
     gcgatgaccg acctgtggtc gcgccgtttc cccgatccgg tcacggcctt cgcgtcgggc       780
     tggatgcgta tccgcgcccg cgcccggcag aacggcgtcg agctgccgct gatcatctcc       840
     gaccatgccg actgggacga tttgcaggac gccatcctcg ccaccggctg cgaggaactc       900
     tgggtcaccc acggccagga ggacgcgctc gtccactggg cactgctggc cggcctacgc       960
     gcccgcccgc tgcacatggt cggctatggc gaggaagagg cggagaccac ggccgccccg      1020
     gacacgagcg cgaccgaaag cccggaggcg cagccttga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page