(data stored in ACNUC1104 zone)

EMBL: CP002026.PE70

CP002026.PE70        Location/Qualifiers
FT   CDS_pept        57591..58526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0070"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Tetratricopeptide
FT                   TPR_2 repeat protein; KEGG: azc:AZC_0395 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87407"
FT                   /db_xref="GOA:D6ZZZ3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADH87407.1"
FT                   /translation="MSAGRLILSSGDPTVDRRIEWARALMEEGKAADAAELLGEAMERA
FT                   GAYAPGWFLLGEAREASGDIAGALDAYRQAQALDAGDRLGSGLRLARLGGASDAEAGMS
FT                   EAYVRTLFDQYAGRFDAALARLDYRGPELIDDALAAACVALGRAYAFARGLDLGCGTGL
FT                   VALRLAEHVGALEGVDLSPNMIAEAKKRGVYEVLVAGEMVAFLAGRPSEDADLIFAGDA
FT                   FCYLADLHPILAETRRVLEPGGLIAFTVETHEGEGILLRDTLRYAHAESYVRAALAAAG
FT                   LELVSCVAESTRKEKEQPVPGLVVVGMRAD"
     atgagtgcag gcaggctcat cctttcctcc ggcgacccga cggtcgatcg ccggatcgag        60
     tgggcgcgcg cgctgatgga ggaaggcaag gccgcggatg cggcggaact actcggcgag       120
     gcgatggagc gggcgggcgc ctatgcgccg ggctggttcc tgctcggcga agcacgcgag       180
     gcgtcggggg atatcgccgg cgcgctcgac gcctaccggc aggcgcaggc gctcgacgcc       240
     ggcgacaggc tcggcagcgg gctgcggctc gctcggctcg gcggggcctc ggatgccgag       300
     gccggcatga gcgaggccta tgtgcgcacc ctgttcgacc aatatgccgg ccgtttcgac       360
     gcggcgctgg cgcggctgga ttatcgcggc ccggagctga tcgacgatgc gctcgccgcc       420
     gcgtgcgtgg ccctcggccg cgcttacgcc ttcgcgcgcg ggctggacct cggctgcggc       480
     accgggttgg tggcgctgcg gctggccgag catgtcgggg cactggaagg cgtcgacctc       540
     tcgcccaaca tgatcgccga ggcgaagaag cgcggggtct acgaggtgct ggtcgccggc       600
     gagatggtcg ccttcctcgc cggtcggccg tccgaggatg ctgacctgat cttcgccggc       660
     gacgccttct gctacctcgc cgaccttcac ccgatcctcg ccgagacccg ccgcgtgctg       720
     gagccgggcg ggctcatcgc cttcaccgtc gagacgcatg agggcgaggg catcctgctg       780
     cgcgacacgc tgcgctatgc gcatgcggaa agctatgtgc gcgcggccct ggcggcggcc       840
     gggctggaac tcgtctcctg cgtcgcggag tcgacgcgga aagagaagga gcagccggtg       900
     cctgggctgg tggtggtggg aatgcgggcg gattga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page