(data stored in ACNUC1104 zone)

EMBL: CP002026.PE71

CP002026.PE71        Location/Qualifiers
FT   CDS_pept        58653..58763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0071"
FT                   /product="metallophosphoesterase"
FT                   /note="KEGG: oca:OCAR_5169 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87408"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ4"
FT                   /inference="similar to AA sequence:KEGG:OCAR_5169"
FT                   /protein_id="ADH87408.1"
FT                   /translation="MKQKTVMAGLDPAIHVFLPAPGPKAWMPGSSPGMTV"
     atgaagcaga agaccgtcat ggccggactt gatccggcca tccacgtctt cctgcccgcg        60
     cccggtccca aggcgtggat gcccggatca agcccgggca tgacggtgta a                111
//

If you have problems or comments...

PBIL Back to PBIL home page