(data stored in ACNUC1104 zone)

EMBL: CP002026.PE75

CP002026.PE75        Location/Qualifiers
FT   CDS_pept        65627..66055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0075"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: azc:AZC_0511 regulatory protein; PFAM:
FT                   Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87412"
FT                   /db_xref="GOA:D6ZZZ8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZZ8"
FT                   /inference="protein motif:PFAM:PF09278"
FT                   /protein_id="ADH87412.1"
FT                   /translation="MDFTSFEAERTADTHAAPSGENAFFTIGDLAREFGVTLRALRFYE
FT                   DKGLLAPRREGLTRLYSPAERSRLAIILKGKKLGFTLAEIKAMVALREGTAPAGGLALT
FT                   REKCVEQLALLETQKTEIEEAIGELRQMVAAFSSRSAA"
     atggatttca cctccttcga ggccgaacgc accgcagaca cgcatgccgc cccgtcgggc        60
     gaaaatgcct tcttcaccat tggtgacctc gcccgcgaat tcggcgtcac gctgcgcgcg       120
     ctgcgcttct atgaggacaa gggcctgctc gccccccgcc gcgagggcct gacccgtctc       180
     tacagcccgg ccgagcggtc gcgcctcgcc atcatcctga agggcaagaa gctcggcttc       240
     acccttgccg agatcaaggc gatggtcgcc ctgcgcgaag gcaccgcccc ggccggtggc       300
     ctcgccctta cccgcgagaa atgtgtggag cagctcgccc tgctcgagac gcagaagacc       360
     gagatcgagg aagccatcgg cgaactccgc cagatggtcg ccgccttctc ctcgcgctcg       420
     gccgcctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page