(data stored in ACNUC1104 zone)

EMBL: CP002026.PE78

CP002026.PE78        Location/Qualifiers
FT   CDS_pept        complement(67381..68373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0078"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: xau:Xaut_1452 alpha/beta hydrolase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87415"
FT                   /db_xref="GOA:D7A001"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7A001"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ADH87415.1"
FT                   /translation="MSSPLPETRASSAAPLVVDPALFEEAAITPETRAINAGIVKALGA
FT                   VPDRWVFPMAMLRKLRLEGKGPFPLAPESSYAQVIEIDGPHGPVPLRILTPPTPPKGVY
FT                   LHIHGGGWCLGSARENDGLNHRFVERTGFAVVSVEYRLAPEEPWPRGPDDCEAAALWLM
FT                   HEGPARFGTDRFAIGGESAGANLSVAVLLRLRDKHGLTPFRAANLTAGAYDLGLTPSAR
FT                   QWGDEPLVLNTRDINVFVGHYLREGGDIALPDISPLQANLKDLPPALFTIGTRDALLDD
FT                   TLFMAPRWLKAGNAAELAIYPGGCHVFIGFPGSLADQALARSHAFVSAC"
     atgtcctctc cgctgcccga aacccgcgcc tcctctgccg ccccgctcgt ggtcgacccc        60
     gccttgttcg aggaggccgc cattacgcct gagacgcggg cgatcaatgc cggcatcgtc       120
     aaggcgctcg gcgccgtgcc ggaccgctgg gtgtttccca tggcgatgct gcgcaagctg       180
     cggctggagg gcaagggtcc gttcccgctg gcgccggaga gctcctatgc gcaggtaatc       240
     gaaatcgacg gcccgcacgg cccggtgccg ctgcgcatcc tcaccccgcc gacgccgccc       300
     aagggcgtct acctgcacat ccatggcggc ggctggtgcc tcggctcggc ccgcgagaac       360
     gacgggctca accaccgctt cgtcgagcgc accggcttcg ccgtggtctc tgtggaatat       420
     cgcctcgcgc cggaggagcc ctggccccgc gggccggacg attgcgaggc cgccgcgctg       480
     tggctgatgc acgaagggcc ggcccgcttc ggcaccgacc gcttcgccat cggtggcgag       540
     tcggcagggg cgaacctctc cgtcgccgtc ctgctgcggc tgcgcgacaa gcacggcctc       600
     acccccttcc gcgccgccaa cctcaccgcc ggcgcctacg acctcggcct gacgccgagc       660
     gcgcggcaat ggggcgacga gccgctggtg ctcaacacgc gggacatcaa cgtcttcgtc       720
     ggccactatc tgagggaggg cggcgatatc gccttgcccg acatctcgcc gctgcaggcc       780
     aatctgaagg acctaccgcc ggcgctgttc accatcggta cccgcgacgc gctcttggac       840
     gacacgctgt tcatggcgcc gcgctggctc aaggccggca atgctgccga gctcgccatc       900
     tatcccggcg gctgccacgt cttcatcggc tttcccggca gcctcgccga ccaggcgctg       960
     gcgcgctccc acgccttcgt ctcggcctgc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page