(data stored in ACNUC1104 zone)

EMBL: CP002026.PE79

CP002026.PE79        Location/Qualifiers
FT   CDS_pept        68490..68954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0079"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   rpb:RPB_4567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87416"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D7A002"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADH87416.1"
FT                   /translation="MARISRGELRESTVTRRFTAMLAVDTPGRGFTDITGAVADFLIAA
FT                   GASEGEVSVFCRHTSASLAIQENADPDVRVDLLTALDRLAPEDAGWAHDMEGPDDMPAH
FT                   VKAMLSGISLSVPVIGGRMALGTWQGLYLIEHRARPHQRELVVAFVGEAY"
     atggccagga tcagccgcgg cgaattgcgg gaaagcacgg tgacgcggcg cttcacggcg        60
     atgctcgccg tcgacacgcc ggggcgcgga ttcaccgaca tcaccggcgc ggtggcggat       120
     ttccttatcg ccgcgggcgc aagcgagggc gaggtgtcgg tgttctgccg gcacacctcg       180
     gcctcgctcg ccatccagga gaacgccgac ccggacgtgc gggtggacct gttgaccgcg       240
     ctcgaccggc tggcgccgga ggatgccggc tgggcgcacg acatggaggg cccggacgac       300
     atgccggcgc atgtgaaggc catgctgagc ggcatcagcc tcagcgtgcc ggtgatcggc       360
     ggccgtatgg cgctcggcac ctggcagggg ctctatctga tcgagcaccg ggcgcggccg       420
     caccagcgcg aattggttgt ggcctttgtc ggcgaggcct actaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page