(data stored in ACNUC1104 zone)

EMBL: CP002026.PE82

CP002026.PE82        Location/Qualifiers
FT   CDS_pept        73483..73911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0082"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="KEGG: xau:Xaut_0055 large conductance
FT                   mechanosensitive channel protein; TIGRFAM: large
FT                   conductance mechanosensitive channel protein; PFAM:
FT                   large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87419"
FT                   /db_xref="GOA:D7A005"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D7A005"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ADH87419.1"
FT                   /translation="MSKVLTEFREFAVKGNVVDLAIGVIIGAAFGQIVTSVVSDLFMPV
FT                   VGAIFGGLDFSNYFVGLSSQVTANNLTAAREQGAVFAYGHFLTVVINFLIVAWILFLVV
FT                   KGINRLRRNAANEPPPPAPPTKEEVLLTEIRDLLAKKV"
     atgagcaaag tgctgacgga attccgcgaa ttcgcggtga agggcaacgt cgtcgatctc        60
     gccatcggcg tcatcatcgg cgcggccttc ggccagatcg tcacctcggt cgtctccgac       120
     ctgttcatgc cggtcgtcgg cgcgatcttc ggcgggctcg acttctccaa ctacttcgtc       180
     ggcctgtcgt cgcaggtgac ggcgaacaac ctcaccgccg cccgcgagca gggtgcggtc       240
     ttcgcctatg gccacttcct caccgtggtg atcaacttcc tcatcgtcgc ctggatcctc       300
     ttcctggtgg tgaagggcat caaccggctg cgccgcaacg cggcgaacga gcccccgccg       360
     cctgccccgc cgaccaagga agaggtgctg ctcaccgaga tccgcgacct gctggctaag       420
     aaggtgtga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page