(data stored in ACNUC1104 zone)

EMBL: CP002026.PE83

CP002026.PE83        Location/Qualifiers
FT   CDS_pept        74140..74721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0083"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="TIGRFAM: dTDP-4-dehydrorhamnose 3,5-epimerase; KEGG:
FT                   xau:Xaut_3548 dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 35-epimerase related"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87420"
FT                   /db_xref="GOA:D7A006"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7A006"
FT                   /inference="protein motif:TFAM:TIGR01221"
FT                   /protein_id="ADH87420.1"
FT                   /translation="MVAFTRLAIPDVVLVQPVRHGDGRGYFCETYKKPAFDAFGIDLAF
FT                   VQDNESLSRPVGVVRGLHFQTPPMAQAKLVRVLRGAIFDVAVDIRRGSPSYGKWVAATL
FT                   TAEEGNQLFMPHGFAHGFCTLEPDTLIAYKVDAPYSRPNDAGIAWDDPDLAIDWPVTTE
FT                   TAVLSDKDRVQPRLRDYASPFAYAPETVRA"
     atggtcgcgt tcacccgcct cgccataccg gatgtcgtcc ttgtccagcc ggtgcggcat        60
     ggcgacgggc gcggctattt ctgcgagacc tacaagaagc cggccttcga cgccttcggc       120
     atcgatctcg ccttcgtgca ggacaacgaa tcgctctccc gcccggtcgg cgtggtgcgc       180
     ggcctgcatt tccagacccc gcccatggcg caggccaagc tcgtgcgcgt cttgcgcggg       240
     gcgatcttcg acgtcgcggt ggacatccgc cggggctcgc cgagctacgg taaatgggtg       300
     gcggcgacgc tgaccgccga agagggcaac cagctcttca tgccgcacgg cttcgcccac       360
     ggcttctgca cgctcgagcc ggacacgctg atcgcctaca aggtcgacgc gccctattcg       420
     cgtccgaacg acgccggcat cgcctgggac gatccggacc tcgccatcga ctggccggtg       480
     acgacggaga cggcggtgct gtcggacaag gaccgcgtgc agccgcgcct gcgcgactat       540
     gccagcccct tcgcctatgc ccccgagacg gtgcgggcct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page