(data stored in ACNUC1104 zone)

EMBL: CP002026.PE85

CP002026.PE85        Location/Qualifiers
FT   CDS_pept        75785..76678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0085"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="TIGRFAM: dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   azc:AZC_1832 dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87422"
FT                   /db_xref="GOA:D7A008"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A008"
FT                   /inference="protein motif:TFAM:TIGR01214"
FT                   /protein_id="ADH87422.1"
FT                   /translation="MTRVLLLGAGGQVGREIAALAPGRVESLTALDHAGLDITDASALK
FT                   AALEQYRPQVVINAAAYTAVDKAESEPEKANLINAVAPGLIAQACASHGAGLIHISTDY
FT                   VFDGTKAGAYVESDPVAPLGVYGASKEAGERAVRDSLDRHLIVRTSWVYGVHGANFLKT
FT                   MLRLAETRDRLTVVADQTGCPTATRDIAEGLLTAAMQLATADVTPGTYHLAGTGVTTWH
FT                   GFASVIVAHAARHTGRHVEVAPITTADYPTPARRPANSELSSALFARTVGYEAAPWQLR
FT                   AAEVVDALFAAKQEAP"
     atgacgcgcg tgctgctgct gggggcgggc gggcaggtcg gccgtgagat cgcggcgctg        60
     gcgccaggac gggtcgagag cctgaccgcg ctcgaccatg ccggcctcga catcaccgat       120
     gccagcgcgc tcaaggcggc gctggagcaa taccggccgc aagtggtgat caacgccgcc       180
     gcctataccg ccgtcgacaa ggcggagagc gagccggaga aggcgaacct catcaacgcc       240
     gtggcgccgg gcctgattgc gcaggcctgt gccagccatg gtgcggggct gatccacatc       300
     tccaccgact acgtcttcga cggcaccaag gccggcgcct atgtggagag cgatccggtc       360
     gcgccgcttg gcgtctatgg cgcctccaag gaggcgggcg agcgggcggt gcgcgacagc       420
     ctcgaccgcc acctcatcgt gcgcacctcc tgggtctatg gcgtccatgg tgccaacttc       480
     ctcaagacca tgctgcggct cgcggagacg cgcgaccggc tcaccgtcgt cgccgaccag       540
     accggctgcc cgaccgccac gcgcgacatc gccgaggggc ttctcaccgc ggcgatgcag       600
     cttgcgaccg ccgacgtgac gcccggcacc tatcatctcg ccggcaccgg cgtgaccacc       660
     tggcacggct tcgccagcgt catcgtcgcg cacgccgccc gccacaccgg ccggcatgtc       720
     gaggtcgcgc cgatcaccac cgccgactat cccaccccgg cgcgccgtcc ggccaattcc       780
     gaattgtcga gcgcgctctt cgcccgcacg gtgggctatg aggccgcgcc gtggcagctt       840
     cgcgcggccg aggtggtcga cgcgctgttc gccgccaaac aagaggcacc atga             894
//

If you have problems or comments...

PBIL Back to PBIL home page