(data stored in ACNUC1104 zone)

EMBL: CP002026.PE87

CP002026.PE87        Location/Qualifiers
FT   CDS_pept        77672..78880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0087"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   xau:Xaut_0300 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87424"
FT                   /db_xref="GOA:D7A010"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7A010"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADH87424.1"
FT                   /translation="MPASLAPSFTPSPLVDHVRPQALALPESGIVEVFNYGRTREGLIP
FT                   LWAGEGDLPTPSFIAEAATRSLAAGETFYTWQRGIPDLRAAIASYMTRLYGVAEDPERY
FT                   FVTGSGMHAVQVALALTVSAGEEVIIPSPEWPNIAAAAEAAGARPVYVPFSFDAGRGFR
FT                   LDLDRLESAVTPRTRAIFINTPANPTGYVASLDELRGVLDIARRHGLWIIADEIYGRFY
FT                   YAAGEGGLAPSFHSIMEPEERILFVQTFSKNWAMTGWRVGWLEAHPSLGDVIENLIQYS
FT                   NSGVAAFMQRAGVAALERGESFVAHQIERAKRGRDIVAEGLASSNRVRFAQPEGAFYMF
FT                   FGVEGEDDTRQLALKLVDEANIGLAPGTAFGPGGEEYIRLCFARGEAQVAEATDRLVRW
FT                   LKR"
     atgcccgcct cgctcgcgcc gtccttcacg ccgtctccac tcgtcgacca tgtccgtccg        60
     caggccctcg ctttgccgga gagcggcatc gtcgaggtgt tcaactatgg ccgtacgcgc       120
     gaggggctga tcccgctctg ggccggcgag ggcgacctcc cgacgccctc cttcatcgcc       180
     gaggcggcga cgcgctctct ggcggcgggc gagaccttct acacctggca gcgcggcata       240
     ccggacctgc gcgccgccat cgccagctac atgacccggc tctacggcgt ggccgaggat       300
     cccgagcgct atttcgtcac cggctccggc atgcacgcgg tgcaggtcgc gctggcgctc       360
     accgtctcgg ccggcgagga ggtgatcatc ccctcgccgg aatggccgaa catcgccgcc       420
     gccgctgagg cggccggcgc tcgcccggtc tacgtgccct tctccttcga cgcggggcgc       480
     ggcttccggc tcgacctcga ccggctggag agcgccgtta ccccgcgcac ccgggcgatc       540
     ttcatcaaca cgccggccaa cccgaccggc tacgtggctt cgctcgatga gctgcgcggc       600
     gtgctcgaca tcgcccgccg gcatgggctg tggattatcg ccgacgagat ctatggccgc       660
     ttctattatg ccgccggcga gggcgggctg gcgccgtcct tccattccat catggagccg       720
     gaggagcgta ttctcttcgt ccagaccttc tccaagaact gggcgatgac cggctggcgc       780
     gtcggctggc tggaggcgca cccctcgctc ggcgacgtga tcgagaacct gatccagtac       840
     tcgaactcgg gtgtcgccgc cttcatgcag cgggcaggcg tcgccgcgct cgagcgcggc       900
     gagagcttcg tcgctcacca gatcgagcgt gccaagcgcg ggcgcgacat cgttgccgag       960
     gggctcgcct cgtcgaaccg cgtgcgcttc gcccagccgg aaggcgcgtt ctacatgttc      1020
     ttcggtgtcg agggcgagga cgacacgcgc cagctcgctc tcaagctcgt ggacgaggcg      1080
     aatatcgggc tcgcgcccgg caccgccttc ggccccggcg gcgaggaata tatccggctg      1140
     tgcttcgccc gcggcgaggc ccaggtggcg gaagcgaccg accggctggt gcgctggctc      1200
     aagaggtga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page