(data stored in ACNUC1104 zone)

EMBL: CP002026.PE88

CP002026.PE88        Location/Qualifiers
FT   CDS_pept        78943..80094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0088"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein;
FT                   histidine kinase A domain protein; KEGG: mea:Mex_1p1833
FT                   PAS/PAC sensor signal transduction histidine kinase
FT                   (fragment); SMART: ATP-binding region ATPase domain
FT                   protein; PAS domain containing protein; histidine kinase A
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87425"
FT                   /db_xref="GOA:D7A011"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A011"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH87425.1"
FT                   /translation="MREFSSPPGPLPPPTVSEARLLSVLDTAADGIIVIDEHARILIFN
FT                   KACEKMFGIAAAEAIGQNVRIVMPIEYAREHDEYLGSYIRTGVKKIIGIGREVRGRHID
FT                   GTIFPLELSVGEAATPDGRQFIGILRDLRPRKESEQRLADLQSELVHLARVSAIDEMGA
FT                   AIAHELNQPLTALMLYLQAIRRAHAKGVDIVKVVGEILDKAAGEAERAGHIIQRMRQFV
FT                   EKREPERHVRELDPLIDEAIDLTLLGQRHRIRIDRKQGTNLPPVSVDPVQVQQIVVNLV
FT                   RNAIEAAAGMTDPAIHIRTRSADGTVVLEVQDNGPGIAPEALSKLFEAFASSKRRGMGL
FT                   GLAISRTIAQNHGGDLLVDPGGNGRGACFSLVLPAAAAPAEVG"
     atgcgcgagt tcagttctcc ccccggaccg cttcctccgc cgaccgtgtc ggaagcgcgg        60
     ctgctgtcgg tgctcgacac tgcggcggac ggcatcatcg tcatcgacga gcatgcgcgc       120
     attctcatct tcaacaaggc ctgcgagaag atgttcggca tcgcggccgc cgaggcgatc       180
     gggcagaacg tcaggatcgt catgccgatc gagtacgcgc gggagcacga cgagtatctc       240
     ggcagctaca ttcgcaccgg cgtgaagaag atcatcggca tcggccgcga agtgcgcggg       300
     cgtcatatcg acggcaccat cttcccgctg gaactgtcgg tcggcgaggc ggcaacgccg       360
     gacgggcggc agttcatcgg catcctgcgc gacctgcgcc cgcgcaagga gagcgagcag       420
     cgcctcgccg acctgcagag cgaactcgtg catcttgccc gcgtctcggc gatcgacgag       480
     atgggcgcgg ccatcgccca tgaactcaac cagccgctca ccgcgctgat gctctacctg       540
     caggcgatca ggcgcgccca cgccaagggc gtcgacatcg tcaaggtcgt cggcgagatc       600
     ctcgacaagg cggcgggcga ggccgagcgc gccggccaca tcatccagcg catgcgccag       660
     ttcgtcgaga agcgtgagcc ggagcggcat gtgcgcgaac tcgacccgct gatcgacgag       720
     gcgatcgacc tcaccctgct gggccagcgc catcgtatcc gcatcgatcg caagcagggc       780
     accaacctgc cgccggtctc ggtcgacccg gtgcaggtgc agcagatcgt ggtcaatctg       840
     gtgcgcaacg ccatcgaggc tgccgccggc atgaccgatc cggcgatcca tatccgcacc       900
     cgcagcgcgg atggcacggt ggtgctggaa gtgcaggaca acgggcccgg catcgcgccg       960
     gaggcgttgt cgaagctgtt cgaggccttc gccagttcaa aacgtcgcgg catgggtctt      1020
     ggccttgcga tttcgcggac gatcgcccag aaccacgggg gggaccttct ggtggatccg      1080
     ggcggcaatg gcaggggtgc atgtttctcg ctggtcctgc cagcggcggc cgcgccggct      1140
     gaagtggggt ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page